| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PPP1R3B Antibody - Azide and BSA Free (H00079660-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-PPP1R3B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PPP1R3B (AAH43388.1, 1 a.a. - 285 a.a.) full-length human protein. MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY |
| Specificity | PPP1R3B - protein phosphatase 1, regulatory (inhibitor) subunit 3B, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PPP1R3B |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00079660-B01P | Applications | Species |
|---|---|---|
| Noguchi Y, Kano F, Maiya N Et Al. Microscopic image-based covariation network analysis for actin scaffold-modified insulin signaling iScience 2021-07-01 [PMID: 34337357] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPP1R3B |
| Entrez |
|
| Uniprot |
|