PPP1R3B Antibody - Azide and BSA Free

Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in rat brain.

Immunocytochemistry/Immunofluorescence: PPP1R3B Antibody [H00079660-B01P] - Analysis of purified antibody to PPP1R3B on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in transfected 293T cell line by PPP1R3B polyclonal antibody. Lane 1: PPP1R3B transfected lysate(31.46 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPP1R3B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PPP1R3B Antibody - Azide and BSA Free (H00079660-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-PPP1R3B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PPP1R3B (AAH43388.1, 1 a.a. - 285 a.a.) full-length human protein. MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
• Specificity: PPP1R3B - protein phosphatase 1, regulatory (inhibitor) subunit 3B,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PPP1R3B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP1R3B Antibody - Azide and BSA Free

• FLJ14005
• FLJ34675
• GL
• Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL
• PPP1R4PP1 subunit R4
• protein phosphatase 1 regulatory subunit 3B
• Protein phosphatase 1 regulatory subunit 4
• Protein phosphatase 1 subunit GL
• protein phosphatase 1, regulatory (inhibitor) subunit 3B

Background

The protein phosphatase-1 (PP1) catalytic subunit (PPP1CA; MIM 176875) is regulated by targeting subunits, such as PP1R3B. PP1R3B suppresses the rate at which PP1 dephosphorylates (i.e., inactivates) glycogen phosphorylase (see PYGL; MIM 232700) and enhances the rate at which it activates glycogen synthase (see GYS2; MIM 138571) (Doherty et al., 1995 [PubMed 7498521]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPP1R3B Antibody (H00079660-B01P)(1)

Publication using H00079660-B01P

• Noguchi Y, Kano F, Maiya N Et Al. Microscopic image-based covariation network analysis for actin scaffold-modified insulin signaling iScience 2021-07-01 [PMID: 34337357]

Bioinformatics

• Gene Symbol: PPP1R3B
• Entrez:
  • 79660(Human)
• Uniprot:
  • AAH43388.1(Human)