Reactivity | Hu, RtSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | PPP1R3B (AAH43388.1, 1 a.a. - 285 a.a.) full-length human protein. MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY |
Specificity | PPP1R3B - protein phosphatase 1, regulatory (inhibitor) subunit 3B, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | PPP1R3B |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00079660-B01P | Applications | Species |
---|---|---|
Noguchi Y, Kano F, Maiya N Et Al. Microscopic image-based covariation network analysis for actin scaffold-modified insulin signaling iScience 2021-07-01 [PMID: 34337357] |
Secondary Antibodies |
Isotype Controls |
Diseases for PPP1R3B Antibody (H00079660-B01P)Discover more about diseases related to PPP1R3B Antibody (H00079660-B01P).
| Pathways for PPP1R3B Antibody (H00079660-B01P)View related products by pathway.
|
PTMs for PPP1R3B Antibody (H00079660-B01P)Learn more about PTMs related to PPP1R3B Antibody (H00079660-B01P).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PPP1R3B |
Entrez |
|
Uniprot |
|