OSTM1 Antibody


Western Blot: OSTM1 Antibody [NBP1-81829] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: OSTM1 Antibody [NBP1-81829] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

OSTM1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP
Specificity of human OSTM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OSTM1 Protein (NBP1-81829PEP)
Read Publications using NBP1-81829.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (89%). Reactivity reported in scientific literature (PMID: 23160729)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for OSTM1 Antibody

  • GIPN
  • GLGAIP-interacting protein N terminus
  • grey-lethal osteopetrosis
  • HSPC019
  • OPTB5
  • osteopetrosis associated transmembrane protein 1
  • osteopetrosis-associated transmembrane protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for OSTM1 Antibody (NBP1-81829)(2)

Reviews for OSTM1 Antibody (NBP1-81829) (0)

There are no reviews for OSTM1 Antibody (NBP1-81829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSTM1 Antibody (NBP1-81829). (Showing 1 - 1 of 1 FAQs).

  1. Does the OSTM1 antibody (NBP1-81829) work on murine tissues or proteins in western blot and immunohistochemistry (frozen sections)?
    • Our OSTM1 antibody (NBP1-81829) has been validated in Human samples for WB/IHC-P applications only. There is a considerable similarity in the immunogen sequence used for this product when compared the same to the OSTM1 sequence of mouse protein, so that there is a pretty good chance of cross-reactivity. Therefore, you may optimize the best suitable conditions for the assay from your testing, and we would be more than happy to provide you our troubleshooting/technical feedback if you come up with any problems in generating your desired outcome. If you decide to test OSTM1 (NBP1-81829) in Mouse/IHC-Fr, and share your results/review feedback with us, please consider our Innovator's Reward program.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for OSTM1 Antibody (NBP1-81829)

Discover related pathways, diseases and genes to OSTM1 Antibody (NBP1-81829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSTM1 Antibody (NBP1-81829)

Discover more about diseases related to OSTM1 Antibody (NBP1-81829).

Pathways for OSTM1 Antibody (NBP1-81829)

View related products by pathway.

PTMs for OSTM1 Antibody (NBP1-81829)

Learn more about PTMs related to OSTM1 Antibody (NBP1-81829).

Blogs on OSTM1

There are no specific blogs for OSTM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OSTM1 Antibody and receive a gift card or discount.


Gene Symbol OSTM1