PSMC6 Antibody (2C4)

Images

 
Western Blot: PSMC6 Antibody (2C4) [H00005706-M02] - PSMC6 monoclonal antibody (M02), clone 2C4. Analysis of PSMC6 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: PSMC6 Antibody (2C4) [H00005706-M02] - Analysis of monoclonal antibody to PSMC6 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PSMC6 Antibody (2C4) [H00005706-M02] - Analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi ( Cat # H00005706-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: PSMC6 Antibody (2C4) [H00005706-M02] - PSMC6 monoclonal antibody (M02), clone 2C4. Analysis of PSMC6 expression in PC-12.
Western Blot: PSMC6 Antibody (2C4) [H00005706-M02] - PSMC6 monoclonal antibody (M02), clone 2C4 Analysis of PSMC6 expression in Hela S3 NE.
Western Blot: PSMC6 Antibody (2C4) [H00005706-M02] - Analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody (M02), clone 2C4.Lane 1: PSMC6 transfected lysate(44.2 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi
Clone
2C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PSMC6 Antibody (2C4) Summary

Immunogen
PSMC6 (AAH05390 290 a.a. - 389 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Specificity
PSMC6 (2C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMC6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMC6 Antibody (2C4)

  • 26S protease regulatory subunit 10B
  • 26S protease regulatory subunit S10B
  • 26S proteasome AAA-ATPase subunit RPT4
  • CADP44
  • conserved ATPase domain protein 44
  • MGC12520
  • p42
  • P44
  • proteasome (prosome, macropain) 26S subunit, ATPase, 6
  • Proteasome 26S subunit ATPase 6
  • Proteasome subunit p42
  • SUG2

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for PSMC6 Antibody (H00005706-M02) (0)

There are no publications for PSMC6 Antibody (H00005706-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMC6 Antibody (H00005706-M02) (0)

There are no reviews for PSMC6 Antibody (H00005706-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMC6 Antibody (H00005706-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMC6 Products

Bioinformatics Tool for PSMC6 Antibody (H00005706-M02)

Discover related pathways, diseases and genes to PSMC6 Antibody (H00005706-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC6 Antibody (H00005706-M02)

Discover more about diseases related to PSMC6 Antibody (H00005706-M02).
 

Pathways for PSMC6 Antibody (H00005706-M02)

View related products by pathway.

Blogs on PSMC6

There are no specific blogs for PSMC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMC6 Antibody (2C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC6
Entrez
OMIM
Uniprot