Tomosyn Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Tomosyn Antibody [NBP2-56176] - Staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining in human parathyroid gland and liver tissues using anti-STXBP5 antibody. Corresponding STXBP5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human parathyroid gland shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tomosyn Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tomosyn Antibody - BSA Free (NBP2-56176) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STXBP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC, Retrieval method: HIER pH6.
• Control Peptide:

  Tomosyn Recombinant Protein Antigen (NBP2-56176PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tomosyn Antibody - BSA Free

• FLJ30922
• Lethal(2) giant larvae protein homolog 3
• LGL3
• LLGL3Nbla04300
• MGC141942
• MGC141968
• putative protein product of Nbla04300
• syntaxin binding protein 5 (tomosyn)
• syntaxin-binding protein 5
• tomosyn
• tomosyn-1

Background

Inhibits translocation of GLUT4 from intracellular vesicles to the plasma membrane. Plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release. Inhibits membrane fusion between transport vesicles and the plasma membrane. May modulate the assembly of trans-SNARE complexes between transport vesicles and the plasma membrane. Competes with STXBP1 for STX1 binding.; SUBUNIT: Part of a complex that contains STXBP5, STX4A and SNAP23. Interacts with STX1A and STX4A via its v-SNARE homology domain. Part of a complex that contains STX1, STXBP5, SNAP25 and SYT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STXBP5