LIN-28B Antibody


Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining in human placenta and prostate tissues using anti-LIN28B antibody. Corresponding LIN28B RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

LIN-28B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
Specificity of human LIN-28B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIN-28B Protein (NBP1-85438PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LIN-28B Antibody

  • CSDD2
  • CSDD2protein lin-28 homolog B
  • FLJ16517
  • lin-28 homolog B (C. elegans)
  • Lin-28.2
  • LIN28B
  • LIN-28B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: IHC, IHC-P

Publications for LIN-28B Antibody (NBP1-85438) (0)

There are no publications for LIN-28B Antibody (NBP1-85438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-28B Antibody (NBP1-85438) (0)

There are no reviews for LIN-28B Antibody (NBP1-85438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIN-28B Antibody (NBP1-85438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LIN-28B Products

Bioinformatics Tool for LIN-28B Antibody (NBP1-85438)

Discover related pathways, diseases and genes to LIN-28B Antibody (NBP1-85438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN-28B Antibody (NBP1-85438)

Discover more about diseases related to LIN-28B Antibody (NBP1-85438).

Pathways for LIN-28B Antibody (NBP1-85438)

View related products by pathway.

PTMs for LIN-28B Antibody (NBP1-85438)

Learn more about PTMs related to LIN-28B Antibody (NBP1-85438).

Research Areas for LIN-28B Antibody (NBP1-85438)

Find related products by research area.

Blogs on LIN-28B

There are no specific blogs for LIN-28B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LIN-28B Antibody and receive a gift card or discount.


Gene Symbol LIN28B