LIN-28B Antibody

Images

 
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIN-28B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIN28B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIN-28B Protein (NBP1-85438PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIN-28B Antibody

  • CSDD2
  • CSDD2protein lin-28 homolog B
  • FLJ16517
  • lin-28 homolog B (C. elegans)
  • Lin-28.2
  • LIN28B
  • LIN-28B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3757
Species: Hu
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-83027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-77093
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP1-85438
Species: Hu
Applications: IHC, IHC-P

Publications for LIN-28B Antibody (NBP1-85438) (0)

There are no publications for LIN-28B Antibody (NBP1-85438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-28B Antibody (NBP1-85438) (0)

There are no reviews for LIN-28B Antibody (NBP1-85438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIN-28B Antibody (NBP1-85438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIN-28B Products

Bioinformatics Tool for LIN-28B Antibody (NBP1-85438)

Discover related pathways, diseases and genes to LIN-28B Antibody (NBP1-85438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN-28B Antibody (NBP1-85438)

Discover more about diseases related to LIN-28B Antibody (NBP1-85438).
 

Pathways for LIN-28B Antibody (NBP1-85438)

View related products by pathway.

PTMs for LIN-28B Antibody (NBP1-85438)

Learn more about PTMs related to LIN-28B Antibody (NBP1-85438).
 

Research Areas for LIN-28B Antibody (NBP1-85438)

Find related products by research area.

Blogs on LIN-28B

There are no specific blogs for LIN-28B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN-28B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN28B
Entrez