IGF2BP1 Antibody

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium, ovary, pancreas and testis using Anti-IGF2BP1 antibody NBP2-38956 (A) shows similar protein distribution across tissues to independent antibody NBP1-83108 (B).

Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Simple Western: IGF2BP1 Antibody [NBP2-38956] - Simple Western lane view shows a specific band for IGF2BP1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: IGF2BP1 Antibody [NBP2-38956] - Electropherogram image of the corresponding Simple Western lane view. IGF2BP1 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IGF2BP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
• Predicted Species: Mouse (96%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGF2BP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
• Control Peptide:

  IGF2BP1 Protein (NBP2-38956PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IGF2BP1 Antibody

• Coding region determinant-binding protein
• CRD-BP
• CRDBPIGF-II mRNA-binding protein 1
• IGF II mRNA binding protein 1
• IMP1
• IMP-1ZBP-1
• insulin-like growth factor 2 mRNA binding protein 1
• insulin-like growth factor 2 mRNA-binding protein 1
• VICKZ family member 1
• VICKZ1
• ZBP1IGF2 mRNA-binding protein 1
• Zip code-binding protein 1
• Zipcode-binding protein 1

Background

The IGF2BP1 gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGF2BP1
• Uniprot:
  • Q9NZI8(Human)