IGF2BP1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium, ovary, pancreas and testis using Anti-IGF2BP1 antibody NBP2-38956 (A) shows similar protein ...read more
Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: IGF2BP1 Antibody [NBP2-38956] - Simple Western lane view shows a specific band for IGF2BP1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: IGF2BP1 Antibody [NBP2-38956] - Electropherogram image of the corresponding Simple Western lane view. IGF2BP1 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGF2BP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Predicted Species
Mouse (96%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGF2BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
IGF2BP1 Protein (NBP2-38956PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGF2BP1 Antibody

  • Coding region determinant-binding protein
  • CRD-BP
  • CRDBPIGF-II mRNA-binding protein 1
  • IGF II mRNA binding protein 1
  • IMP1
  • IMP-1ZBP-1
  • insulin-like growth factor 2 mRNA binding protein 1
  • insulin-like growth factor 2 mRNA-binding protein 1
  • VICKZ family member 1
  • VICKZ1
  • ZBP1IGF2 mRNA-binding protein 1
  • Zip code-binding protein 1
  • Zipcode-binding protein 1

Background

The IGF2BP1 gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84339
Species: Hu
Applications: IHC, IHC-P, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-87512
Species: Hu
Applications: IHC, IHC-P
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00121665-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-24531
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-59475
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for IGF2BP1 Antibody (NBP2-38956) (0)

There are no publications for IGF2BP1 Antibody (NBP2-38956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP1 Antibody (NBP2-38956) (0)

There are no reviews for IGF2BP1 Antibody (NBP2-38956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGF2BP1 Antibody (NBP2-38956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGF2BP1 Products

Bioinformatics Tool for IGF2BP1 Antibody (NBP2-38956)

Discover related pathways, diseases and genes to IGF2BP1 Antibody (NBP2-38956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGF2BP1 Antibody (NBP2-38956)

Discover more about diseases related to IGF2BP1 Antibody (NBP2-38956).
 

Pathways for IGF2BP1 Antibody (NBP2-38956)

View related products by pathway.

PTMs for IGF2BP1 Antibody (NBP2-38956)

Learn more about PTMs related to IGF2BP1 Antibody (NBP2-38956).

Blogs on IGF2BP1

There are no specific blogs for IGF2BP1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGF2BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP1
Uniprot