We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

IGF2BP1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium, ovary, pancreas and testis using Anti-IGF2BP1 antibody NBP2-38956 (A) shows similar protein ...read more
Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Simple Western: IGF2BP1 Antibody [NBP2-38956] - Simple Western lane view shows a specific band for IGF2BP1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: IGF2BP1 Antibody [NBP2-38956] - Electropherogram image of the corresponding Simple Western lane view. IGF2BP1 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.
ChIP-Exo-Seq composite graph for Anti-IGF2BP1 (NBP2-38956) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ChIP, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

IGF2BP1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Predicted Species
Mouse (96%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGF2BP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation 1-10µg per reaction
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 and HCT 116 lysates, separated by Size, antibody dilution of 1:1
Control Peptide
IGF2BP1 Protein (NBP2-38956PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IGF2BP1 Antibody - BSA Free

  • Coding region determinant-binding protein
  • CRD-BP
  • CRDBPIGF-II mRNA-binding protein 1
  • IGF II mRNA binding protein 1
  • IMP1
  • IMP-1ZBP-1
  • insulin-like growth factor 2 mRNA binding protein 1
  • insulin-like growth factor 2 mRNA-binding protein 1
  • VICKZ family member 1
  • VICKZ1
  • ZBP1IGF2 mRNA-binding protein 1
  • Zip code-binding protein 1
  • Zipcode-binding protein 1

Background

The IGF2BP1 gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84339
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, mIF, Simple Western, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-87512
Species: Hu
Applications: IHC,  IHC-P
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP3-46482
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-32505
Species: Hu
Applications: IHC,  IHC-P
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-24531
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-59475
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for IGF2BP1 Antibody (NBP2-38956) (0)

There are no publications for IGF2BP1 Antibody (NBP2-38956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP1 Antibody (NBP2-38956) (0)

There are no reviews for IGF2BP1 Antibody (NBP2-38956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for IGF2BP1 Antibody (NBP2-38956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGF2BP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP1
Uniprot