Leptin R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Leptin R Antibody - BSA Free (NBP1-85765) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LEPR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Leptin R Antibody - BSA Free
Background
Leptin receptor (OB-R) is a type I cytokine receptor family protein with significant amino acid sequence identity with gp130, G-CSF receptor, and LIF receptor. An OB-R transcript encodes a soluble form of the receptor. The transcript was reported to be expressed predominantly in regions of the hypothalamus previously thought to be important in body weight regulation. OB-R binds leptin with high affinity and is a potent leptin antagonist. Human OB-R encodes a 1 165 amino acid residue precursor protein with a 22 amino acid residue signal peptide, an 816 amino acid residue extracellular domain, a 21 amino acid residue transmembrane domain and a 303 amino acid residue cytoplasmic domain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Publications for Leptin R Antibody (NBP1-85765) (0)
There are no publications for Leptin R Antibody (NBP1-85765).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Leptin R Antibody (NBP1-85765) (0)
There are no reviews for Leptin R Antibody (NBP1-85765).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Leptin R Antibody (NBP1-85765). (Showing 1 - 1 of 1 FAQ).
-
I would like to know if the sequence recognized by this antibody is extracellular, so it can be used for flow cytometry.
- The antibody you inquired about, NBP1-85765, was raised against a sequence beginning at amino acid 330 or the protein sequence. According to Uniprot, the extracellular domain of CD295 is predicted to span aa 22-839, which would mean that is where the immunogen sequence is. Having said that, we have not epitope mapped this antibody so cannot say for certain where it binds.
Secondary Antibodies
| |
Isotype Controls
|
Additional Leptin R Products
Research Areas for Leptin R Antibody (NBP1-85765)
Find related products by research area.
|
Blogs on Leptin R