| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 5N8J3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit LAMP-2/CD107b Antibody (5N8J3) (NBP3-15282) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 311-410 of human LAMP-2/CD107b (P13473). FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | LAMP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LAMP-2/CD107b Antibody (NBP3-15282)Find related products by research area.
|
|
Chaperone Mediated Autophagy (CMA) does it all! By Christina Towers, PhD. The degradation of cellular proteins is a critical step of both regulation and quality control and results in the turn over and recycling of critical amino acids. The two main mechanisms o... Read full blog post. |
|
LAMP2 - a marker of lysosomes and late endosomes Lysosomes are membrane-bound organelles responsible for the degradation of various biological macromolecules. Vesicles containing hydrolytic enzymes bud from the Golgi and fuse with endosomes to form the mature lysosome capable of breaking down va... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LAMP2 |