Kv6.1 Antibody


Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81573] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Kv6.1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
Specificity of human Kv6.1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Kv6.1 Protein (NBP1-81573PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv6.1 Antibody

  • KCNG
  • KH2
  • kH2K13
  • Kv6.1
  • MGC12878
  • potassium channel KH2
  • potassium channel Kv6.1
  • potassium voltage-gated channel subfamily G member 1
  • potassium voltage-gated channel, subfamily G, member 1
  • Voltage-gated potassium channel subunit Kv6.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P

Publications for Kv6.1 Antibody (NBP1-81573) (0)

There are no publications for Kv6.1 Antibody (NBP1-81573).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv6.1 Antibody (NBP1-81573) (0)

There are no reviews for Kv6.1 Antibody (NBP1-81573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv6.1 Antibody (NBP1-81573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Kv6.1 Antibody (NBP1-81573)

Discover related pathways, diseases and genes to Kv6.1 Antibody (NBP1-81573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv6.1 Antibody (NBP1-81573)

Discover more about diseases related to Kv6.1 Antibody (NBP1-81573).

Blogs on Kv6.1

There are no specific blogs for Kv6.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv6.1 Antibody and receive a gift card or discount.


Gene Symbol KCNG1