Kv6.1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81573] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv6.1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv6.1 Antibody - BSA Free (NBP1-81573) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Kv6.1 Protein (NBP1-81573PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kv6.1 Antibody - BSA Free

• KCNG
• KH2
• kH2K13
• KV6.1
• MGC12878
• potassium channel KH2
• potassium channel Kv6.1
• potassium voltage-gated channel subfamily G member 1
• potassium voltage-gated channel, subfamily G, member 1
• Voltage-gated potassium channel subunit Kv6.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantlyexpressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal andcancerous tissues. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNG1