Kv5.1 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv5.1 Antibody [NBP2-62639] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Kv5.1 Antibody [NBP2-62639] - Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-KCNF1 antibody. Corresponding KCNF1 ...read more
Immunohistochemistry-Paraffin: Kv5.1 Antibody [NBP2-62639] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Kv5.1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv5.1 Recombinant Protein Antigen (NBP2-62639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Kv5.1 Antibody

  • IK8
  • kH1
  • KV5.1
  • MGC33316
  • potassium channel KH1
  • potassium channel Kv5.1
  • potassium voltage-gated channel subfamily F member 1
  • potassium voltage-gated channel, subfamily F, member 1
  • voltage-gated potassium channel subunit Kv5.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81572
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
H00170850-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-03748
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-98145
Species: Hu
Applications: IHC, IHC-P
NBP3-10293
Species: Hu
Applications: WB
NBP2-17028
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-67689
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-81336
Species: Hu, In
Applications: IHC, IHC-P, WB
NBP2-80429
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00003738-M01
Species: Hu
Applications: ELISA, WB
NBP2-75552
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-14141
Species: Hu
Applications: IHC, IHC-P

Publications for Kv5.1 Antibody (NBP2-62639) (0)

There are no publications for Kv5.1 Antibody (NBP2-62639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv5.1 Antibody (NBP2-62639) (0)

There are no reviews for Kv5.1 Antibody (NBP2-62639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv5.1 Antibody (NBP2-62639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv5.1 Products

Bioinformatics Tool for Kv5.1 Antibody (NBP2-62639)

Discover related pathways, diseases and genes to Kv5.1 Antibody (NBP2-62639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv5.1 Antibody (NBP2-62639)

Discover more about diseases related to Kv5.1 Antibody (NBP2-62639).

PTMs for Kv5.1 Antibody (NBP2-62639)

Learn more about PTMs related to Kv5.1 Antibody (NBP2-62639).

Blogs on Kv5.1

There are no specific blogs for Kv5.1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv5.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNF1