Cytokeratin 4 Antibody (6H9R6)

Western Blot: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Western blot analysis of extracts of various cell lines, using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunofluorescence analysis of mouse large intestine using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [NBP3-15243] - Immunofluorescence analysis of rat rectum using Cytokeratin 4 (KRT4) Rabbit mAb (NBP3-15243) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Confocal imaging of human tonsil tissue using Cytokeratin 4 Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 40x.Perform high pressure antigen retrieval with 10 mM citrate buffer (pH 6.0) before commencing with IF staining protocol.

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human tonsil tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human breast tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytokeratin 4 Antibody (6H9R6) [Cytokeratin 4] - Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using Cytokeratin 4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 6H9R6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytokeratin 4 Antibody (6H9R6) Summary

• Description: Novus Biologicals Rabbit Cytokeratin 4 Antibody (6H9R6) (NBP3-15243) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 4 (P19013). MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KRT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 4 Antibody (6H9R6)

• CK4
• CK-4
• CYK4cytokeratin-4
• Cytokeratin-4
• FLJ31692
• K4cytokeratin 4
• keratin 4
• keratin, type II cytoskeletal 4
• Keratin-4
• Type-II keratin Kb4

Background

Keratins are a family of structurally related proteins that form the intermediate filament cytoskeleton in epithelial cells. White sponge nevus (WSN) is a benign autosomal dominant disorder which affects non-cornifying stratified squamous epithelial. Keratins are expressed in pairs by epithelial cells in a tissue and cell specific manner. The major differentiation specific keratins of the buccal mucosa, nasal, esophageal and anogenital epithelia are CK-4 and CK-13. The tissue distribution and nature of the lesions in patients affected by WSN suggested that mutations in CK-4 and/or CK-13 might be responsible for this disorder (1). K4 and K13 form heterodimers in normal epithelial cells. In humans, K4 is present in all layers of the epidermis at 10 weeks and gradually disappears, starting from the basal layers at 15 weeks and becoming totally absent at around 20 weeks. This period corresponds to the early fetal period when melanoblasts derived from the neural crest migrate through the dermis into the basal layer of the epidermis (2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT4