Involucrin Antibody - BSA Free

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining in human esophagus and stomach tissues. Corresponding IVL RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Involucrin Antibody [NBP2-33742] - Staining of human cell line HaCaT shows localization to nuclear bodies, cytosol & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: citrate. Antibody dilution: 1:100. IHC-P image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human esophagus shows moderate to strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human stomach shows no cytoplasmic positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in squamous epithelial cells.

Simple Western: Involucrin Antibody [NBP2-33742] - Analysis in human HaCaT cells. 200 ug/mL protein concentration and 1/50 antibody dilution. Simmple Western image submitted by a verified customer review.

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Involucrin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Involucrin Antibody - BSA Free (NBP2-33742) is a polyclonal antibody validated for use in IHC, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IVL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in Human HaCaT cells, separated by Size, antibody dilution of 1:50
• Control Peptide:

  Involucrin Protein (NBP2-33742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Involucrin Antibody - BSA Free

• involucrin

Background

Stains paraffin embedded human tissue, so will be useful for studies of changes in involucrin expression in pathological studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for Involucrin Antibody (NBP2-33742) (2)

Average Rating: 3.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Agnès Tessier IHC-P Human 02/27/2020

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Skin tissue
• Species: Human
• Lot: B115840

Comments

• Comments: Reconstructed human epidermis tissues are embedded in paraffin.
  Antigen retrieval: citrate.
  Antibody dilution: 1:100

reviewed by: Agnès Tessier Simple Western Human 06/17/2019

Summary

• Application: Simple Western
• Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
• Species: Human
• Lot: B115840

Comments

• Comments: Detection of involucrin by Simple Western (JESS) in reconstructed human epidermis lysate (about 200 µg/mL protein concentration). Antibody dilution: 1/50 ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: IVL
• Uniprot:
  • P07476(Human)