Involucrin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Involucrin Antibody [NBP2-33742] - Staining of human cell line HaCaT shows localization to nuclear bodies, cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Reconstructed human epidermis tissues are embedded in paraffin. Antigen retrieval: with citrate buffer. Antibody at 1:100. IHC-P image submitted by a ...read more
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human esophagus shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human stomach shows no cytoplasmic positivity in glandular cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining in human esophagus and stomach tissues. Corresponding IVL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Involucrin Antibody [NBP2-33742] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Simple Western: Involucrin Antibody [NBP2-33742] - Analysis in human HaCaT cells. 200 ug/mL protein concentration and 1/50 antibody dilution. Simmple Western image submitted by a verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Involucrin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ
Specificity
Specificity of human Involucrin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IVL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Involucrin Antibody is validated for Simple Western from a verified customer review. IHC-P image submitted by a verified customer review.
Control Peptide
Involucrin Protein (NBP2-33742PEP)
Reviewed Applications
Read 2 Reviews rated 3.5
using
NBP2-33742 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Involucrin Antibody

  • involucrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33610
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-67559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-56916
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67689
Species: Hu, Mu, Fi, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-18885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-33742
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P

Publications for Involucrin Antibody (NBP2-33742) (0)

There are no publications for Involucrin Antibody (NBP2-33742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Involucrin Antibody (NBP2-33742) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP2-33742:
Filter by Applications
IHC-P
(1)
Simple Western
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Involucrin NBP2-33742
Enlarge
4
reviewed by:
Agnès Tessier
IHC-P Human 02/27/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSkin tissue
SpeciesHuman
LotB115840

Comments

CommentsReconstructed human epidermis tissues are embedded in paraffin.
Antigen retrieval: citrate.
Antibody dilution: 1:100
Simple Western Involucrin NBP2-33742
Enlarge
3
reviewed by:
Agnès Tessier
Simple Western Human 06/17/2019
View

Summary

ApplicationSimple Western
Sample TestedHuman foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
SpeciesHuman
LotB115840

Comments

CommentsDetection of involucrin by Simple Western (JESS) in reconstructed human epidermis lysate (about 200 µg/mL protein concentration).
Antibody dilution: 1/50
***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Involucrin Antibody (NBP2-33742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Involucrin Products

Bioinformatics Tool for Involucrin Antibody (NBP2-33742)

Discover related pathways, diseases and genes to Involucrin Antibody (NBP2-33742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Involucrin Antibody (NBP2-33742)

Discover more about diseases related to Involucrin Antibody (NBP2-33742).
 

Pathways for Involucrin Antibody (NBP2-33742)

View related products by pathway.

PTMs for Involucrin Antibody (NBP2-33742)

Learn more about PTMs related to Involucrin Antibody (NBP2-33742).
 

Research Areas for Involucrin Antibody (NBP2-33742)

Find related products by research area.

Blogs on Involucrin

There are no specific blogs for Involucrin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3.5
5
0
4
1
3
1
2
0
1
0

Agnès Tessier
02/27/2020
Application: IHC-P
Species: Human

Agnès Tessier
06/17/2019
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol IVL
Uniprot