KLF10 Antibody (2Y1Q6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118). MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
KLF10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KLF10 Antibody (2Y1Q6)
Background
Transforming growth factor-beta inducible early gene 1 (TIEG1) is a member of the 3 zinc-finger family of Kruppel-like transcription factors. It is also known as Kruppel-like factor 10 (KLF10). TIEG1 functions as an inducer or repressor of gene transcription to regulate the actions of estrogen and TGFbeta signaling and influences the processes of proliferation, differentiation, and apoptosis. Alternative names for TIEG1 include EGR-alpha, EGRA, and TIEG.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: Bind, BA
Species: Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: BA
Publications for KLF10 Antibody (NBP3-16133) (0)
There are no publications for KLF10 Antibody (NBP3-16133).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLF10 Antibody (NBP3-16133) (0)
There are no reviews for KLF10 Antibody (NBP3-16133).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF10 Antibody (NBP3-16133) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF10 Products
Research Areas for KLF10 Antibody (NBP3-16133)
Find related products by research area.
|
Blogs on KLF10