KLF11 Antibody (10D8)

Images

 
Western Blot: KLF11 Antibody (10D8) [H00008462-M03] - Analysis of KLF11 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: KLF11 Antibody (10D8) [H00008462-M03] - Analysis of monoclonal antibody to KLF11 on NIH/3T3 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: KLF11 Antibody (10D8) [H00008462-M03] - Analysis of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
Chromatin Immunoprecipitation: KLF11 Antibody (10D8) [H00008462-M03] - 5 ug KLF11 antibody on human adipocytes - data from a customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
10D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KLF11 Antibody (10D8) Summary

Immunogen
KLF11 (NP_003588 404 a.a. - 512 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Specificity
KLF11 - Kruppel-like factor 11 (10D8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLF11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, ELISA, ChIP and IHC-P. IP usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00008462-M03 in the following applications:

Publications
Read Publications using
H00008462-M03 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    3 publications

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF11 Antibody (10D8)

  • FKLFFKLF1
  • Krueppel-like factor 11
  • Kruppel-like factor 11
  • MODY7TGFB-inducible early growth response protein 2
  • TIEG-2
  • TIEG2TGFB inducible early growth response 2
  • Tieg3
  • Transforming growth factor-beta-inducible early growth response protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB200-107
Species: Hu, Mu
Applications: WB, ELISA, Flow, GS, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP2-45511
Species: Hu
Applications: WB, IHC
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA

Publications for KLF11 Antibody (H00008462-M03)(4)

Review for KLF11 Antibody (H00008462-M03) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00008462-M03:
Filter by Applications
ChIP
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Chromatin Immunoprecipitation KLF11 H00008462-M03
Enlarge
reviewed by:
Anne Loft
ChIP Human 12/02/2013
View

Summary

ApplicationChromatin Immunoprecipitation
Sample TestedHuman adipocytes
SpeciesHuman

Primary Anitbody

Dilution Ratio5 ug of antibody - incubation O.N. at 4 degrees

Details

Detection NotesRT-PCR
DNS SharingSonication with Biorupter, 30s ON/ 30s for 48 cycles
Immunoprecipitation DetailsProtein A beads
Crosslinking/Reversal Details1% formaldehyde for 10 min at RT, followed by addition of 0.125M glycine
DNA Prurification DetailsPhenol-chloroform extraction

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLF11 Antibody (H00008462-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF11 Products

Bioinformatics Tool for KLF11 Antibody (H00008462-M03)

Discover related pathways, diseases and genes to KLF11 Antibody (H00008462-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF11 Antibody (H00008462-M03)

Discover more about diseases related to KLF11 Antibody (H00008462-M03).
 

Pathways for KLF11 Antibody (H00008462-M03)

View related products by pathway.

PTMs for KLF11 Antibody (H00008462-M03)

Learn more about PTMs related to KLF11 Antibody (H00008462-M03).
 

Research Areas for KLF11 Antibody (H00008462-M03)

Find related products by research area.

Blogs on KLF11

There are no specific blogs for KLF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anne Loft
12/02/2013
Application: ChIP
Species: Human

Bioinformatics

Gene Symbol KLF11
Entrez
Uniprot