IRF6 Antibody


Independent Antibodies: Western Blot: IRF6 Antibody [NBP2-55961] - Analysis using Anti-IRF6 antibody NBP2-55961 (A) shows similar pattern to independent antibody NBP2-49383 (B).
Immunocytochemistry/ Immunofluorescence: IRF6 Antibody [NBP2-55961] - Staining of human cell line HaCaT shows localization to cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Validated by:

Independent Antibodies


Order Details

IRF6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLP
Specificity of human IRF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for IRF6 Antibody

  • interferon regulatory factor 6
  • IRF6
  • IRF-6
  • LPS
  • OFC6
  • PIT
  • PPS
  • Van der Woude syndrome
  • VWS
  • VWS1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for IRF6 Antibody (NBP2-55961) (0)

There are no publications for IRF6 Antibody (NBP2-55961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF6 Antibody (NBP2-55961) (0)

There are no reviews for IRF6 Antibody (NBP2-55961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF6 Antibody (NBP2-55961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IRF6 Products

Bioinformatics Tool for IRF6 Antibody (NBP2-55961)

Discover related pathways, diseases and genes to IRF6 Antibody (NBP2-55961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF6 Antibody (NBP2-55961)

Discover more about diseases related to IRF6 Antibody (NBP2-55961).

Pathways for IRF6 Antibody (NBP2-55961)

View related products by pathway.

PTMs for IRF6 Antibody (NBP2-55961)

Learn more about PTMs related to IRF6 Antibody (NBP2-55961).

Blogs on IRF6

There are no specific blogs for IRF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IRF6 Antibody and receive a gift card or discount.


Gene Symbol IRF6