NDUFB6 Antibody - BSA Free

Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.

Analysis in human cell line NB4.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB6 Antibody - BSA Free (NBP1-92172) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NDUFB6 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDUFB6 Protein (NBP1-92172PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFB6 Antibody - BSA Free

• B17
• CI
• CI-B17
• complex I, mitochondrial respiratory chain, B17 subunit
• Complex I-B17
• MGC13675
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
• NADH-ubiquinone oxidoreductase B17 subunit
• NADH-ubiquinone oxidoreductase beta subunit, 6

Background

NDUFB6 is encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFB6 Antibody (NBP1-92172)(2)

Publications using NBP1-92172

• Pang Y, Lu Y, et al. Targeting NAD+/PARP DNA Repair Pathway as a Novel Therapeutic Approach to SDHB-Mutated Cluster I Pheochromocytoma and Paraganglioma. Clin Cancer Res 2018-07-15 [PMID: 29636359] (IF/IHC, WB, Human)
• Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human)

Bioinformatics

• Gene Symbol: NDUFB6