Integrin beta 2/CD18 Antibody

Images

 
Western Blot: Integrin beta 2/CD18 Antibody [NBP1-88128] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Integrin beta 2/CD18 Antibody [NBP1-88128] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin beta 2/CD18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin beta 2/CD18 Protein (NBP1-88128PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin beta 2/CD18 Antibody

  • 959 beta subunit precursor)10
  • CD18 antigen
  • CD18
  • CD18beta 2
  • cell surface adhesion glycoprotein (LFA-1
  • CR3
  • Integrin beta 2
  • integrin beta-2
  • integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1;macrophage antigen 1 (mac-1) beta subunit)
  • integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
  • ITGB2
  • LAD
  • LCAMB
  • leukocyte cell adhesion molecule CD18
  • leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C
  • LFA-1 beta
  • LFA-1
  • MAC-1 beta
  • MF17
  • MFI7
  • P150
  • p150,95 beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

796-IC
Species: Mu
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88128
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Integrin beta 2/CD18 Antibody (NBP1-88128) (0)

There are no publications for Integrin beta 2/CD18 Antibody (NBP1-88128).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 2/CD18 Antibody (NBP1-88128) (0)

There are no reviews for Integrin beta 2/CD18 Antibody (NBP1-88128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 2/CD18 Antibody (NBP1-88128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 2/CD18 Products

Bioinformatics Tool for Integrin beta 2/CD18 Antibody (NBP1-88128)

Discover related pathways, diseases and genes to Integrin beta 2/CD18 Antibody (NBP1-88128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 2/CD18 Antibody (NBP1-88128)

Discover more about diseases related to Integrin beta 2/CD18 Antibody (NBP1-88128).
 

Pathways for Integrin beta 2/CD18 Antibody (NBP1-88128)

View related products by pathway.

PTMs for Integrin beta 2/CD18 Antibody (NBP1-88128)

Learn more about PTMs related to Integrin beta 2/CD18 Antibody (NBP1-88128).
 

Research Areas for Integrin beta 2/CD18 Antibody (NBP1-88128)

Find related products by research area.

Blogs on Integrin beta 2/CD18.

CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies
The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 2/CD18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB2
Entrez