Integrin alpha 8 Antibody (2G7) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
ITGA8 (NP_003629, 836 a.a. ~ 935 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA |
| Specificity |
ITGA8 - integrin, alpha 8 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ITGA8 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Frozen
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Integrin alpha 8 Antibody (2G7) - Azide and BSA Free
Background
ITGA8 is a gene that codes for a protein that functions in the genesis of kidneys and other organs by facilitating the recruitment of mesenchymal cells into epithelial structures as well as working as a neuronal receptor for TNC to regulate neurite outgrowth, and is made up of 1063 amino acids, weighs approximately 117 kDa. Studies are being conducted on several diseases and disorders including keratopathy, carcinoma, kidney disease, laryngitis, Parkinson's disease, glomerulonephritis, Alzheimer's disease, melanoma, hepatitis, and neuronitis. ITGA8 has also been shown to have interactions with FN1, ITGB1, ITGA3, NPNT, and VNT in pathways such as the CDK5, Tec kinases signaling, integrin-mediated cell adhesion, signal transduction, and hypertrophic cardiomyopathy pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB, ELISA, IHC
Publications for Integrin alpha 8 Antibody (H00008516-M02)(1)
Showing Publication 1 -
1 of 1.
Reviews for Integrin alpha 8 Antibody (H00008516-M02) (0)
There are no reviews for Integrin alpha 8 Antibody (H00008516-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin alpha 8 Antibody (H00008516-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin alpha 8 Products
Blogs on Integrin alpha 8