Integrin alpha 8 Antibody (2G7)

Images

 
Sandwich ELISA: Integrin alpha 8 Antibody (2G7) [H00008516-M02] - Detection limit for recombinant GST tagged ITGA8 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha 8 Antibody (2G7) Summary

Immunogen
ITGA8 (NP_003629 836 a.a. - 935 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Specificity
ITGA8 - integrin, alpha 8
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00008516-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 8 Antibody (2G7)

  • Integrin alpha 8
  • integrin alpha-8
  • integrin, alpha 8
  • ITGA8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-27418
Species: Hu, Pm
Applications: WB
AF8035
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
BBA37
Species: Hu
Applications: AdBlk
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 8 Antibody (H00008516-M02)(1)

Reviews for Integrin alpha 8 Antibody (H00008516-M02) (0)

There are no reviews for Integrin alpha 8 Antibody (H00008516-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 8 Antibody (H00008516-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 8 Products

Bioinformatics Tool for Integrin alpha 8 Antibody (H00008516-M02)

Discover related pathways, diseases and genes to Integrin alpha 8 Antibody (H00008516-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 8 Antibody (H00008516-M02)

Discover more about diseases related to Integrin alpha 8 Antibody (H00008516-M02).
 

Pathways for Integrin alpha 8 Antibody (H00008516-M02)

View related products by pathway.

PTMs for Integrin alpha 8 Antibody (H00008516-M02)

Learn more about PTMs related to Integrin alpha 8 Antibody (H00008516-M02).

Blogs on Integrin alpha 8

There are no specific blogs for Integrin alpha 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 8 Antibody (2G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA8
Entrez
OMIM
Uniprot