Integrin alpha 3B Antibody (54B3) - BSA Free

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: 54B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Integrin alpha 3B Antibody (54B3) - BSA Free Summary

• Description: The antibody is shipped at ambient temperature and may be stored at 4C. For prolonged storage prepare appropriate aliquots and store at or below -20C. Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2). Repeated thawing and freezing should be avoided. Working dilutions should be stored at 4C, not refrozen, and preferably used the same day. If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance or the concentration of the product.
• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:25-1:200
  • Western Blot 1:100-1:1000
• Application Notes: This antibody is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:25 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications..

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A or G purified

Alternate Names for Integrin alpha 3B Antibody (54B3) - BSA Free

• AA407068
• CD49C
• GAPB3
• integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha 3B Antibody (NBP1-97732)(1)

Publication using NBP1-97732

• Eick S, Gadzo N, Tacchi M et al. Gingipains impair attachment of epithelial cell to dental titanium abutment surfaces J. Biomed. Mater. Res. Part B Appl. Biomater. 2019-02-14 [PMID: 30763463] (WB, Human)

Bioinformatics

• Gene Symbol: ITGA3