Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: 54B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: CoraFluor 1

Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1] Summary

• Description: CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(IM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined..

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

• AA407068
• CD49C
• GAPB3
• integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3