We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

Images

 
7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser." > CoraFluor™  1, amine reactive (Catalog:<a class=7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser." title="CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser." />
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
54B3
Clonality
Monoclonal
Host
Mouse
Conjugate
CoraFluor 1

Order Details

Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Specificity
This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA3
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-97732. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark. Do not freeze.
Buffer
PBS
Preservative
No Preservative
Purity
Protein A or G purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for Integrin alpha 3B Antibody (54B3) [CoraFluor™ 1]

  • AA407068
  • CD49C
  • GAPB3
  • integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52680
Species: Hu
Applications: B/N, CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
AF796
Species: Mu
Applications: AdBlk, IHC, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
7268-CT
Species: Hu
Applications: BA
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-77333
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF5676
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-97732CL1
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Integrin alpha 3B Antibody (NBP1-97732CL1) (0)

There are no publications for Integrin alpha 3B Antibody (NBP1-97732CL1).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3B Antibody (NBP1-97732CL1) (0)

There are no reviews for Integrin alpha 3B Antibody (NBP1-97732CL1). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 3B Antibody (NBP1-97732CL1) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 3B Products

Array NBP1-97732CL1

Blogs on Integrin alpha 3B

There are no specific blogs for Integrin alpha 3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3B Antibody (54B3) [CoraFluor&#8482; 1] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3