We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 647]

Images

 
There are currently no images for Integrin alpha 3B Antibody (NBP1-97732AF647).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
54B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 647

Order Details

Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 647] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Specificity
This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ITGA3
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-97732. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 647]

  • AA407068
  • CD49C
  • GAPB3
  • integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52680
Species: Hu
Applications: B/N, CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
AF796
Species: Mu
Applications: AdBlk, IHC, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
7268-CT
Species: Hu
Applications: BA
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-77333
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF5676
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
AF1172
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-97732AF647
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Integrin alpha 3B Antibody (NBP1-97732AF647) (0)

There are no publications for Integrin alpha 3B Antibody (NBP1-97732AF647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3B Antibody (NBP1-97732AF647) (0)

There are no reviews for Integrin alpha 3B Antibody (NBP1-97732AF647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Integrin alpha 3B Antibody (NBP1-97732AF647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 3B Products

Array NBP1-97732AF647

Blogs on Integrin alpha 3B

There are no specific blogs for Integrin alpha 3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 3B Antibody (54B3) [Alexa Fluor® 647] and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3