Integrin alpha 3B Antibody (54B3) [HRP]

• Reactivity: Hu
• Applications: WB, IHC
• Clone: 54B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: HRP

Integrin alpha 3B Antibody (54B3) [HRP] Summary

• Description: This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
• Immunogen: Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Specificity: This antibody recognizes specifically the cytoplasmic domain of integrin subunit Integrin alpha 3B which is present in microvascular structures in brain and heart.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined..

Reactivity Notes

A broad species reactivity is expected because of the conserved nature of the epitope.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Protein A or G purified

Alternate Names for Integrin alpha 3B Antibody (54B3) [HRP]

• AA407068
• CD49C
• GAPB3
• integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3