Integrin alpha 3B Antibody (54B3) [PerCP]

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: 54B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: PerCP

Integrin alpha 3B Antibody (54B3) [PerCP] Summary

• Description: This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
  
  For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
• Immunogen: Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
• Specificity: 54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Western Blot
• Application Notes: Recommended applications are based on validated applications from the unconjugated base product NBP1-97732. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Protein A or G purified

Alternate Names for Integrin alpha 3B Antibody (54B3) [PerCP]

• AA407068
• CD49C
• GAPB3
• integrin alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA3