| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INS. Source: E. coli Amino Acid Sequence: SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | INS |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87485. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Insulin Protein (NBP1-87485PEP)Find related products by research area.
|
|
Immune Cell Metabolic Flux Influences Type I Diabetes By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev... Read full blog post. |
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
|
Insulin signaling in adipocytes: Carbohydrate-signaling transcription factor ChREBP is the link between lipolytic enzyme Hormone-Sensitive Lipase and lipogenic enzyme ELOVL6 By Jamshed Arslan, Pharm. D., PhD. Insulin resistance in adipocytes is a major feature of metabolic syndrome . Disrupted adipose tissue metabolism can lead to accumulation of lipid intermediates in insul... Read full blog post. |
|
Inhibiting incretin GIP hormone activity in mouse and monkey models to combat obesity By Jamshed Arslan, Pharm. D., PhD. We live in a world where 39% of adults are overweight. Our meals trigger the secretion of various gut-derived metabolic hormones called incretins. Fats and carbohydrates in our die... Read full blog post. |
|
Insulin signaling in brain’s subfornical organ is crucial for regulating cardiometabolic profile By Jamshed Arslan, Pharm. D., PhD. The hypothalamus is an insulin receptor-rich brain region. Insulin receptor signaling in the CNS can regulate blood pressure, for example, by increasing sympathetic outflow to th... Read full blog post. |
|
Eat responsibly: Epigenetic downregulation of Ankrd26 gene by long-term high-fat intake promotes obesity and inflammation By Jamshed Arslan Pharm.D. White adipose tissue (WAT) represents the primary site to store energy in humans. WAT’s endocrine regulation of energy balance is controlled by nutritional status, exercise, and hormones l... Read full blog post. |
|
Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu... Read full blog post. |
|
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
|
AMPK Alpha 1 and lipid metabolism of adipocytes AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress. AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene... Read full blog post. |
|
ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | INS |