Inhibin alpha Antibody


Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining in human testis and endometrium tissues using anti-INHA antibody. Corresponding INHA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Inhibin alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT
Specificity of human Inhibin alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Inhibin alpha Recombinant Protein Antigen (NBP1-87563PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Inhibin alpha Antibody

  • A-inhibin subunit
  • INHA
  • Inhibin A
  • inhibin alpha chain
  • inhibin, alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Inhibin alpha Antibody (NBP1-87563) (0)

There are no publications for Inhibin alpha Antibody (NBP1-87563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inhibin alpha Antibody (NBP1-87563) (0)

There are no reviews for Inhibin alpha Antibody (NBP1-87563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Inhibin alpha Antibody (NBP1-87563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Inhibin alpha Products

Bioinformatics Tool for Inhibin alpha Antibody (NBP1-87563)

Discover related pathways, diseases and genes to Inhibin alpha Antibody (NBP1-87563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inhibin alpha Antibody (NBP1-87563)

Discover more about diseases related to Inhibin alpha Antibody (NBP1-87563).

Pathways for Inhibin alpha Antibody (NBP1-87563)

View related products by pathway.

PTMs for Inhibin alpha Antibody (NBP1-87563)

Learn more about PTMs related to Inhibin alpha Antibody (NBP1-87563).

Research Areas for Inhibin alpha Antibody (NBP1-87563)

Find related products by research area.

Blogs on Inhibin alpha

There are no specific blogs for Inhibin alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Inhibin alpha Antibody and receive a gift card or discount.


Gene Symbol INHA