Inhibin alpha Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry: Inhibin alpha Antibody [NBP1-87563] - Staining of human testis shows distinct positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Inhibin alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INHA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Inhibin alpha Protein (NBP1-87563PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Inhibin alpha Antibody

  • A-inhibin subunit
  • INHA
  • Inhibin A
  • inhibin alpha chain
  • inhibin, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-79413
Species: Hu
Applications: WB
NBP2-56413
Species: Hu
Applications: WB, ICC/IF
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24689
Species: Hu, Mu
Applications: WB
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87563
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Inhibin alpha Antibody (NBP1-87563) (0)

There are no publications for Inhibin alpha Antibody (NBP1-87563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inhibin alpha Antibody (NBP1-87563) (0)

There are no reviews for Inhibin alpha Antibody (NBP1-87563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Inhibin alpha Antibody (NBP1-87563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Inhibin alpha Products

Bioinformatics Tool for Inhibin alpha Antibody (NBP1-87563)

Discover related pathways, diseases and genes to Inhibin alpha Antibody (NBP1-87563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inhibin alpha Antibody (NBP1-87563)

Discover more about diseases related to Inhibin alpha Antibody (NBP1-87563).
 

Pathways for Inhibin alpha Antibody (NBP1-87563)

View related products by pathway.

PTMs for Inhibin alpha Antibody (NBP1-87563)

Learn more about PTMs related to Inhibin alpha Antibody (NBP1-87563).
 

Research Areas for Inhibin alpha Antibody (NBP1-87563)

Find related products by research area.

Blogs on Inhibin alpha

There are no specific blogs for Inhibin alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Inhibin alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INHA
Entrez