URI Antibody


Western Blot: URI Antibody [NBP1-79413] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in MCF7.
Western Blot: URI Antibody [NBP1-79413] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: URI Antibody [NBP1-79413] - Hela, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HeLa.
Western Blot: URI Antibody [NBP1-79413] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HepG2.
Western Blot: URI Antibody [NBP1-79413] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

URI Antibody Summary

Synthetic peptide directed towards the middle region of human C19orf2. Peptide sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against C19orf2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for URI Antibody

  • chromosome 19 open reading frame 2
  • FLJ10575
  • NNX3RPB5-mediating protein
  • Protein NNX3
  • RMPunconventional prefoldin RPB5 interactor
  • RNA polymerase II subunit 5-mediating protein
  • URIRNA polymerase II, subunit 5-mediating protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for URI Antibody (NBP1-79413) (0)

There are no publications for URI Antibody (NBP1-79413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for URI Antibody (NBP1-79413) (0)

There are no reviews for URI Antibody (NBP1-79413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for URI Antibody (NBP1-79413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for URI Antibody (NBP1-79413)

Discover related pathways, diseases and genes to URI Antibody (NBP1-79413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for URI Antibody (NBP1-79413)

Discover more about diseases related to URI Antibody (NBP1-79413).

Pathways for URI Antibody (NBP1-79413)

View related products by pathway.

PTMs for URI Antibody (NBP1-79413)

Learn more about PTMs related to URI Antibody (NBP1-79413).

Blogs on URI

There are no specific blogs for URI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our URI Antibody and receive a gift card or discount.


Gene Symbol URI1