IL-15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IL-15 Antibody [NBP2-55162] - Staining of human cell line A549 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-15 Antibody - BSA Free (NBP2-55162) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IL-15 Recombinant Protein Antigen (NBP2-55162PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-15 Antibody - BSA Free

• IL15
• IL-15
• IL-15MGC9721
• interleukin 15
• interleukin-15

Background

IL-15 (14-15 kD) is a member of the four alpha-helical bundle family of cytokines. It is very similar to IL-2, except that IL-15 has an IL-15 alpha receptor subunit. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules. This implies that IL-15 could be essential for the immune responses, allograft rejection, and the pathogenesis of autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL15