ICAP-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ICAP-1 Antibody [NBP2-68856] - Staining of human cell line U-251 MG shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICAP-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB1BP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ICAP-1 Recombinant Protein Antigen (NBP2-68856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ICAP-1 Antibody

  • Bodenin
  • DKFZp686K08158
  • ICAP1
  • ICAP-1
  • ICAP-1alpha
  • ICAP-1B
  • ICAP1ICAP1AICAP1BICAP-1A
  • integrin beta 1 binding protein 1
  • integrin beta-1-binding protein 1
  • Integrin cytoplasmic domain-associated protein 1
  • integrin cytoplasmic domain-associated protein 1-alpha
  • integrin cytoplasmic domain-associated protein 1-beta
  • ITGB1BP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47405
Species: Hu
Applications: IHC, IHC-P
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP2-01134
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1389
Species: Mu
Applications: ICC, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
2308-VN
Species: Hu
Applications: BA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-89110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-68856
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ICAP-1 Antibody (NBP2-68856) (0)

There are no publications for ICAP-1 Antibody (NBP2-68856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICAP-1 Antibody (NBP2-68856) (0)

There are no reviews for ICAP-1 Antibody (NBP2-68856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ICAP-1 Antibody (NBP2-68856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICAP-1 Products

Bioinformatics Tool for ICAP-1 Antibody (NBP2-68856)

Discover related pathways, diseases and genes to ICAP-1 Antibody (NBP2-68856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICAP-1 Antibody (NBP2-68856)

Discover more about diseases related to ICAP-1 Antibody (NBP2-68856).
 

Pathways for ICAP-1 Antibody (NBP2-68856)

View related products by pathway.

PTMs for ICAP-1 Antibody (NBP2-68856)

Learn more about PTMs related to ICAP-1 Antibody (NBP2-68856).
 

Research Areas for ICAP-1 Antibody (NBP2-68856)

Find related products by research area.

Blogs on ICAP-1

There are no specific blogs for ICAP-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICAP-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB1BP1