Home » ICAP-1 » ICAP-1 Antibodies » ICAP-1 Antibody

ICAP-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ICAP-1 Antibody [NBP2-68856] - Staining of human cell line U-251 MG shows localization to nuclear bodies.
Immunocytochemistry/ Immunofluorescence: ICAP-1 Antibody [NBP2-68856] - Staining of human cell line U-251 MG shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ICAP-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB1BP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ICAP-1 Recombinant Protein Antigen (NBP2-68856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ICAP-1 Antibody

  • Bodenin
  • DKFZp686K08158
  • ICAP1
  • ICAP-1
  • ICAP-1alpha
  • ICAP-1B
  • ICAP1ICAP1AICAP1BICAP-1A
  • integrin beta 1 binding protein 1
  • integrin beta-1-binding protein 1
  • Integrin cytoplasmic domain-associated protein 1
  • integrin cytoplasmic domain-associated protein 1-alpha
  • integrin cytoplasmic domain-associated protein 1-beta
  • ITGB1BP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KRIT1 Antibody
NBP2-47405
Immunohistochemistry: KRIT1 Antibody [NBP2-47405] - Staining of human small intestine shows distinct positivity in a subset of vessels.
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human duodenum shows strong cytoplasmic positivity in blood vessels.
Immunohistochemistry-Paraffin: KRIT1 Antibody [NBP2-47405] - Staining of human heart muscle shows strong cytoplasmic positivity in blood vessels.
Species: Hu
Applications: IHC, IHC-P
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
Integrin  beta 1/CD29 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A549 human lung carcinoma cell line was stained with Mouse Anti-Human Integrin  beta 1/CD29 Monoclonal Antibody (Catalog # MAB17781, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(4 Reviews)
(23 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
RAP1A Antibody
(1D4-1A3)
NBP2-22527
Immunoprecipitation: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 was performed on NIH3T3 cells. Antigen-antibody complexes were formed by incubating 750ug of NIH3T3 whole cell lysate with 2ug of a Rap1 monoclonal antibody overnight on a rocking platform at 4C. The immune complexes were captured on 50ul Protein A/G Plus Agarose, washed extensively, and eluted with 5X Lane Marker Reducing Sample BUffer. Eluted sample (right lane) and 25ug of NIH3T3 control lysate (left lane) were resolved on a 4-20% Tris-HCl polyacrylamide gel, transferred to a PVDF membrane, and blocked with 5% BSA/TBS-0.1%Tween for at least 1 hour. The membrane was probed with a Rap1 monoclonal antibody at a dilution of 1:500 overnight rotating at 4C, washed in TBST, and probed with Clean-Blot IP Detection Reagent at a dilution of 1:2500 for at least 1 hour. Chemiluminescent detection was performed using SuperSignal West Dura.
Immunocytochemistry/Immunofluorescence: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 (green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% BSA/TBST for 15 minutes at room temperature. Cells were probed with a Rap1 monoclonal antibody at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis showing staining in the cytoplasm and membrane of human kidney tissue (right) compared to a negative control without primary antibody (left).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
CCM2 Antibody
(OTI1E9)
NBP2-01134
Western Blot: CCM2 Antibody (1E9) [NBP2-01134] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CCM2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CCM2.
Immunohistochemistry-Paraffin: CCM2 Antibody (1E9) [NBP2-01134] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-CCM2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: CCM2 Antibody (1E9) [NBP2-01134] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-CCM2 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
NM23-H1 Antibody
(1D7)
H00004830-M02
ELISA: NM23-H1 Antibody (1D7) [H00004830-M02] - Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.
Western Blot: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7.Lane 1: NME1 transfected lysate(19.7 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of monoclonal antibody to NME1 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DLL4 Antibody
[Unconjugated]
AF1389
Western blot shows lysates of bEnd.3 mouse endothelioma cell line. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for DLL4 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
DLL4 was detected in immersion fixed bEnd.3 mouse endothelioma cell line using Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
DLL4 was detected in immersion fixed paraffin-embedded sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing vasculature. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(27 Publications)
Species: Mu
Applications: ICC, IHC, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NM23-H2/NME2
Antibody (1D3)
H00004831-M06
Western Blot: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of NME2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of monoclonal antibody to NME2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody (1D3) [H00004831-M06] - Analysis of monoclonal antibody to NME2 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Vitronectin
[Unconjugated]
2308-VN
Vitronectin [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(7 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
RhoA Antibody
NB100-91273
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry-Paraffin: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin section) using Rabbit antibody to Transforming protein RhoA (Arha, Arha2): whole serum at 1 : 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
(1 Review)
(4 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ILK Antibody
NBP2-89110
Western Blot: ILK Antibody [NBP2-89110] - Analysis of Integrin linked ILK on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody was used at a 1:500 dilution in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Mouse skeletal muscle tissue lysateLane 2: Rat lung tissue lysate
Immunocytochemistry/Immunofluorescence: ILK Antibody [NBP2-89110] - Staining Integrin linked ILK in A431 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with Integrin linked ILK polyclonal antibody at a dilution of 1:100 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunocytochemistry/Immunofluorescence: ILK Antibody [NBP2-89110] - Staining Integrin linked ILK in MG-63 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with Integrin linked ILK polyclonal antibody at a dilution of 1:50 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
ICAP-1 Antibody
NBP2-68856
ICAP-1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ICAP-1 Antibody (NBP2-68856) (0)

There are no publications for ICAP-1 Antibody (NBP2-68856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICAP-1 Antibody (NBP2-68856) (0)

There are no reviews for ICAP-1 Antibody (NBP2-68856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ICAP-1 Antibody (NBP2-68856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICAP-1 Products

Bioinformatics Tool for ICAP-1 Antibody (NBP2-68856)

Discover related pathways, diseases and genes to ICAP-1 Antibody (NBP2-68856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICAP-1 Antibody (NBP2-68856)

Discover more about diseases related to ICAP-1 Antibody (NBP2-68856).
 

Pathways for ICAP-1 Antibody (NBP2-68856)

View related products by pathway.

PTMs for ICAP-1 Antibody (NBP2-68856)

Learn more about PTMs related to ICAP-1 Antibody (NBP2-68856).
 

Research Areas for ICAP-1 Antibody (NBP2-68856)

Find related products by research area.

Blogs on ICAP-1

There are no specific blogs for ICAP-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICAP-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGB1BP1