ILK Antibody (4F10)

Images

 
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10. Analysis of ILK expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: ILK Antibody (4F10) [H00003611-M01] - Analysis of monoclonal antibody to ILK on Jurkat cell. Antibody concentration 10 ug/ml.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - Analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi ( Cat # H00003611-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10 Analysis of ILK expression in HeLa.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10. Analysis of ILK expression in PC-12.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10. Analysis of ILK expression in HepG2.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - ILK monoclonal antibody (M01), clone 4F10. Analysis of ILK expression in Raw 264.7.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - Analysis of ILK expression in transfected 293T cell line by ILK monoclonal antibody (M01), clone 4F10.Lane 1: ILK transfected lysate(51.4 KDa).Lane 2: Non-transfected ...read more
Sandwich ELISA: ILK Antibody (4F10) [H00003611-M01] - Detection limit for recombinant GST tagged ILK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi
Clone
4F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ILK Antibody (4F10) Summary

Immunogen
ILK (AAH01554 341 a.a. - 452 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Specificity
ILK - integrin-linked kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ILK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Positive Control
ILK Lysate (NBP2-64801)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ILK Antibody (4F10)

  • 59 kDa serine/threonine-protein kinase
  • DKFZp686F1765
  • EC 2.7.11.1
  • ESTM24
  • ILK
  • ILK1
  • ILK-1
  • ILK2
  • ILK-2
  • integrin-linked kinase
  • integrin-linked kinase-2
  • integrin-linked protein kinase
  • p59
  • p59ILK

Background

Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46326
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IP, B/N
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for ILK Antibody (H00003611-M01) (0)

There are no publications for ILK Antibody (H00003611-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILK Antibody (H00003611-M01) (0)

There are no reviews for ILK Antibody (H00003611-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ILK Antibody (H00003611-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ILK Antibody (H00003611-M01)

Discover related pathways, diseases and genes to ILK Antibody (H00003611-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILK Antibody (H00003611-M01)

Discover more about diseases related to ILK Antibody (H00003611-M01).
 

Pathways for ILK Antibody (H00003611-M01)

View related products by pathway.

PTMs for ILK Antibody (H00003611-M01)

Learn more about PTMs related to ILK Antibody (H00003611-M01).
 

Research Areas for ILK Antibody (H00003611-M01)

Find related products by research area.

Blogs on ILK.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILK Antibody (4F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ILK
Entrez
OMIM
Uniprot