NM23-H1 Antibody

Images

 
Western Blot: NME1-NME2 Antibody [NBP1-80992] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: NME1-NME2 Antibody [NBP1-80992] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: NME1-NME2 Antibody [NBP1-80992] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Western Blot: NME1-NME2 Antibody [NBP1-80992] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NM23-H1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 21738817). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NM23-H1 Recombinant Protein Antigen (NBP1-80992PEP)
Publications
Read Publications using
NBP1-80992 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 21738817).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NM23-H1 Antibody

  • EC 2.7.4.6
  • GAAD
  • Granzyme A-activated DNase
  • Metastasis inhibition factor nm23
  • NB
  • NBS
  • NDK A
  • NDKA
  • NDP kinase A
  • NDPKA
  • NDPK-A
  • NM23A
  • NM23AWD
  • NM23H1
  • NM23-H1
  • NME1
  • non-metastatic cells 1, protein (NM23A) expressed in
  • nucleoside diphosphate kinase A
  • Tumor metastatic process-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-67605
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-98675
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB

Publications for NM23-H1 Antibody (NBP1-80992)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NM23-H1 Antibody (NBP1-80992) (0)

There are no reviews for NM23-H1 Antibody (NBP1-80992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NM23-H1 Antibody (NBP1-80992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NM23-H1 Products

Bioinformatics Tool for NM23-H1 Antibody (NBP1-80992)

Discover related pathways, diseases and genes to NM23-H1 Antibody (NBP1-80992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NM23-H1 Antibody (NBP1-80992)

Discover more about diseases related to NM23-H1 Antibody (NBP1-80992).
 

Pathways for NM23-H1 Antibody (NBP1-80992)

View related products by pathway.

PTMs for NM23-H1 Antibody (NBP1-80992)

Learn more about PTMs related to NM23-H1 Antibody (NBP1-80992).

Blogs on NM23-H1

There are no specific blogs for NM23-H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NM23-H1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME1
Entrez
Uniprot