ICAM-1/CD54 Antibody

Images

 
Western Blot: ICAM-1/CD54 Antibody [NBP1-88700] - Analysis in human lung tissue.
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human lung shows distinct membranous positivity in alveolar cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICAM-1/CD54 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ICAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ICAM-1/CD54 Recombinant Protein Antigen (NBP1-88700PEP)
Publications
Read Publication using NBP1-88700.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22093360)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ICAM-1/CD54 Antibody

  • BB2
  • CD54 antigen
  • CD54
  • cell surface glycoprotein P3.58
  • human rhinovirus receptor
  • ICAM1
  • ICAM-1
  • intercellular adhesion molecule 1 (CD54), human rhinovirus receptor
  • intercellular adhesion molecule 1
  • Major group rhinovirus receptor
  • P3.58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for ICAM-1/CD54 Antibody (NBP1-88700)(1)

Reviews for ICAM-1/CD54 Antibody (NBP1-88700) (0)

There are no reviews for ICAM-1/CD54 Antibody (NBP1-88700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICAM-1/CD54 Antibody (NBP1-88700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ICAM-1/CD54 Products

Bioinformatics Tool for ICAM-1/CD54 Antibody (NBP1-88700)

Discover related pathways, diseases and genes to ICAM-1/CD54 Antibody (NBP1-88700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICAM-1/CD54 Antibody (NBP1-88700)

Discover more about diseases related to ICAM-1/CD54 Antibody (NBP1-88700).
 

Pathways for ICAM-1/CD54 Antibody (NBP1-88700)

View related products by pathway.

PTMs for ICAM-1/CD54 Antibody (NBP1-88700)

Learn more about PTMs related to ICAM-1/CD54 Antibody (NBP1-88700).

Blogs on ICAM-1/CD54

There are no specific blogs for ICAM-1/CD54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICAM-1/CD54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ICAM1
Entrez