HVSL1 Antibody

Images

 
Western Blot: HVSL1 Antibody [NBP1-82268] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: HVSL1 Antibody [NBP1-82268] - Staining of human colon shows moderate luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HVSL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSM
Specificity
Specificity of human HVSL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HVSL1 Protein (NBP1-82268PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HVSL1 Antibody

  • C16orf57
  • chromosome 16 open reading frame 57
  • FLJ13154
  • HVSL motif containing 1
  • HVSL1
  • hypothetical protein LOC79650
  • PN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-04611
Species: Hu
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00003249-P01
Species: Hu
Applications: WB
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HVSL1 Antibody (NBP1-82268) (0)

There are no publications for HVSL1 Antibody (NBP1-82268).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HVSL1 Antibody (NBP1-82268) (0)

There are no reviews for HVSL1 Antibody (NBP1-82268). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HVSL1 Antibody (NBP1-82268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HVSL1 Antibody (NBP1-82268)

Discover related pathways, diseases and genes to HVSL1 Antibody (NBP1-82268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HVSL1 Antibody (NBP1-82268)

Discover more about diseases related to HVSL1 Antibody (NBP1-82268).
 

Pathways for HVSL1 Antibody (NBP1-82268)

View related products by pathway.

Blogs on HVSL1

There are no specific blogs for HVSL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HVSL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USB1