HSPA2 Antibody

Images

 
Western Blot: HSPA2 Antibody [NBP1-86185] - Analysis in human testis tissue.
Immunocytochemistry/ Immunofluorescence: HSPA2 Antibody [NBP1-86185] - Staining of mouse amygdala shows positivity in neurons.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in decidual cells.
Western Blot: HSPA2 Antibody [NBP1-86185] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: HSPA2 Antibody [NBP1-86185] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Western Blot: HSPA2 Antibody [NBP1-86185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: HSPA2 Antibody [NBP1-86185] - Staining of mouse thalamus shows strong immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: HSPA2 Antibody [NBP1-86185] - Staining of mouse somatosensory cortex shows strong immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human cerebral cortex shows moderate immunoreactivity in neuropil and neuronal cell bodies.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human cerebellum shows strong immunoreactivity in a subset of glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPA2 Protein (NBP1-86185PEP)
Publications
Read Publications using
NBP1-86185 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24899640).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPA2 Antibody

  • Heat shock 70 kDa protein 2
  • heat shock 70kD protein 2
  • heat shock 70kDa protein 2
  • heat shock-related 70 kDa protein 2
  • HSP70-2
  • HSP70-3
  • HSPA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003304-M02
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-86185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSPA2 Antibody (NBP1-86185)(4)

Reviews for HSPA2 Antibody (NBP1-86185) (0)

There are no reviews for HSPA2 Antibody (NBP1-86185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSPA2 Antibody (NBP1-86185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSPA2 Products

Bioinformatics Tool for HSPA2 Antibody (NBP1-86185)

Discover related pathways, diseases and genes to HSPA2 Antibody (NBP1-86185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPA2 Antibody (NBP1-86185)

Discover more about diseases related to HSPA2 Antibody (NBP1-86185).
 

Pathways for HSPA2 Antibody (NBP1-86185)

View related products by pathway.

PTMs for HSPA2 Antibody (NBP1-86185)

Learn more about PTMs related to HSPA2 Antibody (NBP1-86185).
 

Research Areas for HSPA2 Antibody (NBP1-86185)

Find related products by research area.

Blogs on HSPA2

There are no specific blogs for HSPA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA2
Entrez