HSPA2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Analysis in human testis and pancreas tissues. Corresponding HSPA2 RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: HSPA2 Antibody [NBP1-86185] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Western Blot: HSPA2 Antibody [NBP1-86185] - Analysis in human testis tissue.
Western Blot: HSPA2 Antibody [NBP1-86185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Analysis in human testis and pancreas tissues. Corresponding HSPA2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: HSPA2 Antibody [NBP1-86185] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
Specificity
Specificity of human HSPA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
IHC, WB reported in scientific literature (PMID: 24899640). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSPA2 Protein (NBP1-86185PEP)
Publications
Read Publications using
NBP1-86185 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24899640).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPA2 Antibody

  • Heat shock 70 kDa protein 2
  • heat shock 70kD protein 2
  • heat shock 70kDa protein 2
  • heat shock-related 70 kDa protein 2
  • HSP70-2
  • HSP70-3
  • HSPA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-61582
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Ch, Dr, Fi, Gp, Ha, Pm, Rb, Sh
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IM, MiAr, Bind
NBP1-92012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003304-M02
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, PLA
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NBP1-86185
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for HSPA2 Antibody (NBP1-86185)(5)

Reviews for HSPA2 Antibody (NBP1-86185) (0)

There are no reviews for HSPA2 Antibody (NBP1-86185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSPA2 Antibody (NBP1-86185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSPA2 Products

Bioinformatics Tool for HSPA2 Antibody (NBP1-86185)

Discover related pathways, diseases and genes to HSPA2 Antibody (NBP1-86185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPA2 Antibody (NBP1-86185)

Discover more about diseases related to HSPA2 Antibody (NBP1-86185).
 

Pathways for HSPA2 Antibody (NBP1-86185)

View related products by pathway.

PTMs for HSPA2 Antibody (NBP1-86185)

Learn more about PTMs related to HSPA2 Antibody (NBP1-86185).
 

Research Areas for HSPA2 Antibody (NBP1-86185)

Find related products by research area.

Blogs on HSPA2

There are no specific blogs for HSPA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA2