Orthogonal Strategies: Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Analysis in human testis and endometrium tissues. Corresponding HspA1L RNA-seq data are presented for the same tissues.
Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human prostate shows no positivity in glandular cells as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Orthogonal Strategies: Analysis in human testis and endometrium tissues using NBP1-92012 antibody. Corresponding HSPA1L RNA-seq data are presented for the same tissues.
Novus Biologicals Rabbit HspA1L Antibody - BSA Free (NBP1-92012) is a polyclonal antibody validated for use in IHC, WB and IP. Anti-HspA1L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HspA1L Antibody - BSA Free
heat shock 10kDa protein 1-like
Heat shock 70 kDa protein 1-Hom
Heat shock 70 kDa protein 1L
heat shock 70 kDa protein 1-like
heat shock 70kD protein-like 1
heat shock 70kDa protein 1-like
HSP70-1L
HSP70-HOM
HSP70T
hum70t
Background
HSPA1L encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for HspA1L Antibody (NBP1-92012). (Showing 1 - 1 of 1 FAQ).
Does the protein array contain other HSP70 (HSP70/HSPA1A)?
The proteins used in their protein array analysis is proprietary; however based on a blast of the immunogen, the closest homology to any other HSP is 59% to HSPA2.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HspA1L Antibody - BSA Free and receive a gift card or discount.