HspA1L Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Analysis in human testis and endometrium tissues. Corresponding HspA1L RNA-seq data are presented for the same tissues.
Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human prostate shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HspA1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HspA1L Protein (NBP1-92012PEP)
Publications
Read Publication using
NBP1-92012 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HspA1L Antibody

  • heat shock 10kDa protein 1-like
  • Heat shock 70 kDa protein 1-Hom
  • Heat shock 70 kDa protein 1L
  • heat shock 70 kDa protein 1-like
  • heat shock 70kD protein-like 1
  • heat shock 70kDa protein 1-like
  • HSP70-1L
  • HSP70-HOM
  • HSP70T
  • hum70t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003304-M02
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86185
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85949
Species: Hu, Po
Applications: IHC, IHC-P, WB
211-TBB/CF
Species: Hu
Applications: BA
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-88019
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
796-IC
Species: Mu
Applications: BA
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-92012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for HspA1L Antibody (NBP1-92012)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HspA1L Antibody (NBP1-92012) (0)

There are no reviews for HspA1L Antibody (NBP1-92012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HspA1L Antibody (NBP1-92012). (Showing 1 - 1 of 1 FAQ).

  1. Does the protein array contain other HSP70 (HSP70/HSPA1A)?
    • The proteins used in their protein array analysis is proprietary; however based on a blast of the immunogen, the closest homology to any other HSP is 59% to HSPA2.

Secondary Antibodies

 

Isotype Controls

Additional HspA1L Products

Bioinformatics Tool for HspA1L Antibody (NBP1-92012)

Discover related pathways, diseases and genes to HspA1L Antibody (NBP1-92012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspA1L Antibody (NBP1-92012)

Discover more about diseases related to HspA1L Antibody (NBP1-92012).
 

Pathways for HspA1L Antibody (NBP1-92012)

View related products by pathway.

PTMs for HspA1L Antibody (NBP1-92012)

Learn more about PTMs related to HspA1L Antibody (NBP1-92012).
 

Research Areas for HspA1L Antibody (NBP1-92012)

Find related products by research area.

Blogs on HspA1L

There are no specific blogs for HspA1L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HspA1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA1L