HSPA2 Antibody


Western Blot: HSPA2 Antibody [NBP1-58213] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: HSPA2 Antibody [NBP1-58213] - Human Hela, Antibody Dilution: 1.0 ug/ml HSPA2 is supported by BioGPS gene expression data to be expressed in HeLa.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HSPA2 Antibody Summary

Synthetic peptides corresponding to HSPA2(heat shock 70kDa protein 2) The peptide sequence was selected from the middle region of HSPA2. Peptide sequence ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HSPA2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSPA2 Antibody

  • Heat shock 70 kDa protein 2
  • heat shock 70kD protein 2
  • heat shock 70kDa protein 2
  • heat shock-related 70 kDa protein 2
  • HSP70-2
  • HSP70-3
  • HSPA2


HSPA2 belongs to the heat shock protein 70 family.In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for HSPA2 Antibody (NBP1-58213) (0)

There are no publications for HSPA2 Antibody (NBP1-58213).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPA2 Antibody (NBP1-58213) (0)

There are no reviews for HSPA2 Antibody (NBP1-58213). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSPA2 Antibody (NBP1-58213) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HSPA2 Products

Bioinformatics Tool for HSPA2 Antibody (NBP1-58213)

Discover related pathways, diseases and genes to HSPA2 Antibody (NBP1-58213). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPA2 Antibody (NBP1-58213)

Discover more about diseases related to HSPA2 Antibody (NBP1-58213).

Pathways for HSPA2 Antibody (NBP1-58213)

View related products by pathway.

PTMs for HSPA2 Antibody (NBP1-58213)

Learn more about PTMs related to HSPA2 Antibody (NBP1-58213).

Research Areas for HSPA2 Antibody (NBP1-58213)

Find related products by research area.

Blogs on HSPA2

There are no specific blogs for HSPA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSPA2 Antibody and receive a gift card or discount.


Gene Symbol HSPA2