DNA Polymerase delta, catalytic subunit Antibody

Images

 
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: ...read more
Immunocytochemistry/ Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for ...read more
Immunohistochemistry: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Polymerase delta, catalytic subunit Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPD
Specificity
Specificity of human DNA Polymerase delta, catalytic subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Polymerase delta, catalytic subunit Protein (NBP2-33466PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Polymerase delta, catalytic subunit Antibody

  • CDC2 homolog
  • CDC2
  • DNA polymerase delta catalytic subunit
  • DNA polymerase subunit delta p125
  • DNA-directed polymerase delta 1
  • EC 2.7.7.7
  • POLD
  • polymerase (DNA directed), delta 1, catalytic subunit (125kD)
  • polymerase (DNA directed), delta 1, catalytic subunit 125kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466) (0)

There are no publications for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466) (0)

There are no reviews for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466)

Discover related pathways, diseases and genes to DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466)

Discover more about diseases related to DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466).
 

Pathways for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466)

View related products by pathway.

PTMs for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466)

Learn more about PTMs related to DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466).
 

Research Areas for DNA Polymerase delta, catalytic subunit Antibody (NBP2-33466)

Find related products by research area.

Blogs on DNA Polymerase delta, catalytic subunit

There are no specific blogs for DNA Polymerase delta, catalytic subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Polymerase delta, catalytic subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD1
Uniprot