HSD3B1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HSD3B1 Antibody - BSA Free (NBP2-33386) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HSD3B1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HSD3B1 Antibody - BSA Free
Background
3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase (HSD3B1) is a bifunctional enzyme involved in the oxidative conversion of steroids and plays an important role in the synthesis of all steroid hormones. There are two HSD3B1 proteins--designated type I and type II--that are expressed by different genes and function in different areas of the body. HSD3B1 has also been shown to be a highly specific and sensitive trophoblast-associated marker.
HSD3B1 is required for the production of progesterone by the placenta, so it is predicted that mutations in this gene may cause infertility in women. HSD3B1 antibodies are useful tools for researchers studying hormone regulation and reproductive biology.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Hu
Applications: IHC, IHC-P
Publications for HSD3B1 Antibody (NBP2-33386) (0)
There are no publications for HSD3B1 Antibody (NBP2-33386).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HSD3B1 Antibody (NBP2-33386) (0)
There are no reviews for HSD3B1 Antibody (NBP2-33386).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HSD3B1 Antibody (NBP2-33386) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HSD3B1 Products
Research Areas for HSD3B1 Antibody (NBP2-33386)
Find related products by research area.
|
Blogs on HSD3B1