HPD Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Analysis in human liver and endometrium tissues. Corresponding HPD RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Staining of human endometrium, kidney, liver and squamous epithelia using Anti-HPD antibody NBP1-89366 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: HPD Antibody [NBP1-89366] - Analysis using Anti-HPD antibody NBP1-89366 (A) shows similar pattern to independent antibody NBP2-32657 (B).
Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Staining of human squamous epithelia shows no positivity in squamous epithelial cells as expected.
Western Blot: HPD Antibody [NBP1-89366] - Analysis in mouse liver tissue and rat liver tissue.
Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPD Protein (NBP1-89366PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPD Antibody

  • 4HPPDEC 1.13.11.27,4-HPPD
  • 4-hydroxyphenylpyruvate dioxygenase
  • GLOD3
  • glyoxalase domain containing 3,4-hydroxyphenylpyruvic acid oxidase
  • HPPDASE
  • PPD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP2-75618
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86665
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
M5000
Species: Mu
Applications: ELISA
NBP1-20194
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87382
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20428
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
D6050
Species: Hu
Applications: ELISA
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for HPD Antibody (NBP1-89366) (0)

There are no publications for HPD Antibody (NBP1-89366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPD Antibody (NBP1-89366) (0)

There are no reviews for HPD Antibody (NBP1-89366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPD Antibody (NBP1-89366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPD Products

Bioinformatics Tool for HPD Antibody (NBP1-89366)

Discover related pathways, diseases and genes to HPD Antibody (NBP1-89366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPD Antibody (NBP1-89366)

Discover more about diseases related to HPD Antibody (NBP1-89366).
 

Pathways for HPD Antibody (NBP1-89366)

View related products by pathway.

PTMs for HPD Antibody (NBP1-89366)

Learn more about PTMs related to HPD Antibody (NBP1-89366).

Blogs on HPD

There are no specific blogs for HPD, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPD