Migfilin Antibody

Images

 
Western Blot: Migfilin Antibody [NBP1-86665] - Analysis in control (vector only transfected HEK293T lysate) and FBLIM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Migfilin Antibody [NBP1-86665] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: Migfilin Antibody [NBP1-86665] - Analysis in human cell lines A-431 and MCF-7 using Anti-FBLIM1 antibody. Corresponding FBLIM1 RNA-seq data are presented for the same cell ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Migfilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV
Specificity
Specificity of human Migfilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-86665.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 22253135)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Migfilin Antibody

  • CAL
  • DKFZp434G171
  • FBLP-1FBLP1CSX-associated LIM
  • filamin binding LIM protein 1
  • filamin-binding LIM protein 1
  • filamin-binding LIM protein-1
  • MIG2-interacting protein
  • migfilin
  • mitogen-inducible 2 interacting protein
  • Mitogen-inducible 2-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32657
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52926
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gt, GP, Rb, Sh, Ye, Ze
Applications: WB
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-56060
Species: Hu
Applications: ICC/IF
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-05985
Species: Hu
Applications: WB (-), IP
NBP2-76932
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-12553
Species: Hu
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready

Publications for Migfilin Antibody (NBP1-86665)(1)

Reviews for Migfilin Antibody (NBP1-86665) (0)

There are no reviews for Migfilin Antibody (NBP1-86665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Migfilin Antibody (NBP1-86665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Migfilin Products

Bioinformatics Tool for Migfilin Antibody (NBP1-86665)

Discover related pathways, diseases and genes to Migfilin Antibody (NBP1-86665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Migfilin Antibody (NBP1-86665)

Discover more about diseases related to Migfilin Antibody (NBP1-86665).
 

Pathways for Migfilin Antibody (NBP1-86665)

View related products by pathway.

PTMs for Migfilin Antibody (NBP1-86665)

Learn more about PTMs related to Migfilin Antibody (NBP1-86665).

Blogs on Migfilin

There are no specific blogs for Migfilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Migfilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLIM1