Migfilin Antibody

Images

 
Orthogonal Strategies: Western Blot: Migfilin Antibody [NBP1-86665] - Analysis in human cell lines A-431 and MCF-7 using Anti-FBLIM1 antibody. Corresponding FBLIM1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: Migfilin Antibody [NBP1-86665] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Migfilin Antibody [NBP1-86665] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Migfilin Antibody [NBP1-86665] - Staining of human gallbladder shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Migfilin Antibody [NBP1-86665] - Staining of human kidney shows weak cytoplasmic positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Migfilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Migfilin Protein (NBP1-86665PEP)
Publications
Read Publications using NBP1-86665.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Migfilin Antibody

  • CAL
  • DKFZp434G171
  • FBLP-1FBLP1CSX-associated LIM
  • filamin binding LIM protein 1
  • filamin-binding LIM protein 1
  • filamin-binding LIM protein-1
  • MIG2-interacting protein
  • migfilin
  • mitogen-inducible 2 interacting protein
  • Mitogen-inducible 2-interacting protein

Background

FBLIM1 encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Migfilin Antibody (NBP1-86665)(2)

Reviews for Migfilin Antibody (NBP1-86665) (0)

There are no reviews for Migfilin Antibody (NBP1-86665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Migfilin Antibody (NBP1-86665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Migfilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLIM1