EYA1 Antibody

Images

 
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: EYA1 Antibody [NBP2-87382] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody
Western Blot: EYA1 Antibody [NBP2-87382] - WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human PC-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human U937 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

EYA1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EYA1. Peptide sequence: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
EYA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for EYA1 Antibody

  • BOP
  • BOR
  • EC 3.1.3.48
  • eyes absent (Drosophila) homolog 1
  • eyes absent homolog 1 (Drosophila)
  • eyes absent homolog 1
  • MGC141875

Background

The EYA1 gene encodes an eyes absent homolog 1 protein that exists in three isoforms: isoform 1: 592 amino acids long, 64 kDA; isoform 2: 559 amino acids long, 61 kDA; and isoform 3: 557 amino acids long; 60 kDA. The protein coded by the EYA1 gene functions in the development of the kidney, brancial arches, eyes, and ears. Mutations in the EYA1 gene lead to branchiootorenal dysplasia syndrome, congenital cataracts and ocular anterior segment anomalies, and branchiootic syndrome. The EYA1 gene is also linked to fraser syndrome, microphthalmia, cataracts, enlarged vestibular aqueducts, townes-brocks syndrome, and anophthalmia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EYA1 Antibody (NBP2-87382) (0)

There are no publications for EYA1 Antibody (NBP2-87382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA1 Antibody (NBP2-87382) (0)

There are no reviews for EYA1 Antibody (NBP2-87382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYA1 Antibody (NBP2-87382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EYA1 Products

Research Areas for EYA1 Antibody (NBP2-87382)

Find related products by research area.

Blogs on EYA1

There are no specific blogs for EYA1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA1