PIST Antibody

Images

 
Western Blot: PIST Antibody [NBP1-88223] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: PIST Antibody [NBP1-88223] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: PIST Antibody [NBP1-88223] - Staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIST Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOPC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIST Protein (NBP1-88223PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIST Antibody

  • CALPDZ protein interacting specifically with TC10
  • CFTR-associated ligand
  • dJ94G16.2
  • FIGdJ94G16.2 PIST
  • Fused in glioblastoma
  • golgi-associated PDZ and coiled-coil motif containing
  • Golgi-associated PDZ and coiled-coil motif-containing protein
  • GOPC1
  • PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10
  • PISTGolgi associated PDZ and coiled-coil motif containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52926
Species: Hu
Applications: WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-56060
Species: Hu
Applications: ICC/IF
H00030813-R02
Species: Hu
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-2307
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05984
Species: Hu, Mu
Applications: WB, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-88223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIST Antibody (NBP1-88223) (0)

There are no publications for PIST Antibody (NBP1-88223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIST Antibody (NBP1-88223) (0)

There are no reviews for PIST Antibody (NBP1-88223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIST Antibody (NBP1-88223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIST Products

Bioinformatics Tool for PIST Antibody (NBP1-88223)

Discover related pathways, diseases and genes to PIST Antibody (NBP1-88223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIST Antibody (NBP1-88223)

Discover more about diseases related to PIST Antibody (NBP1-88223).
 

Pathways for PIST Antibody (NBP1-88223)

View related products by pathway.

PTMs for PIST Antibody (NBP1-88223)

Learn more about PTMs related to PIST Antibody (NBP1-88223).

Blogs on PIST

There are no specific blogs for PIST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOPC