HMG-CoA Reductase/HMGCR Antibody

Images

 
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human appendix shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMG-CoA Reductase/HMGCR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Specificity
Specificity of human, mouse HMG-CoA Reductase/HMGCR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 27497529).
Control Peptide
HMG-CoA Reductase/HMGCR Recombinant Protein Antigen (NBP1-91996PEP)
Publications
Read Publications using
NBP1-91996 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23471651). Mouse reactivity reported in scientific literature (PMID: 27497529).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HMG-CoA Reductase/HMGCR Antibody

  • 3-hydroxy-3-methylglutaryl CoA reductase (NADPH)
  • 3-hydroxy-3-methylglutaryl-CoA reductase
  • 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
  • EC 1.1.1
  • EC 1.1.1.34
  • HMG-CoA Reductase
  • HMGCR
  • Hydroxymethylglutaryl-CoA Reductase
  • LDLCQ3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
MAB9120
Species: Hu
Applications: ICC
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-91996
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)(4)

Reviews for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996) (0)

There are no reviews for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996). (Showing 1 - 1 of 1 FAQs).

  1. If we use this antibody for western blot, what is the predicted protein size?
    • HMGCR is a 887 amino acids long protein with a predicted size of 96.7 kDa. However, this protein undergoes extensive glycosylation and the molecular weight of the post-translationally modified protein will be more than the predicted size Uniprot Site

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)

Discover related pathways, diseases and genes to HMG-CoA Reductase/HMGCR Antibody (NBP1-91996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)

Discover more about diseases related to HMG-CoA Reductase/HMGCR Antibody (NBP1-91996).
 

Pathways for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)

View related products by pathway.

PTMs for HMG-CoA Reductase/HMGCR Antibody (NBP1-91996)

Learn more about PTMs related to HMG-CoA Reductase/HMGCR Antibody (NBP1-91996).

Blogs on HMG-CoA Reductase/HMGCR

There are no specific blogs for HMG-CoA Reductase/HMGCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMG-CoA Reductase/HMGCR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGCR
Entrez