ACAT1 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum, kidney, liver and testis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar protein ...read more
Genetic Strategies: Western Blot: ACAT1 Antibody [NBP1-89284] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ACAT1 antibody. Remaining relative ...read more
Independent Antibodies: Western Blot: ACAT1 Antibody [NBP1-89284] - Analysis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar pattern to independent antibody NBP1-89285 (B).
Immunocytochemistry/ Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum shows moderate positivity in mitochondria in Purkinje cells.
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human testis shows strong positivity in mitochondria in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong positivity in mitochondria in hepatocytes.

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. ACAT1 antibody validated for WB from a verified customer review.
Control Peptide
ACAT1 Protein (NBP1-89284PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89284 in the following applications:

Publications
Read Publications using NBP1-89284.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%). Reactivity reported in scientific literature (PMID: 22361696). Porcine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAT1 Antibody

  • ACAT
  • ACAT1
  • acetoacetyl Coenzyme A thiolase
  • Acetoacetyl-CoA thiolase
  • acetyl-CoA acetyltransferase 1
  • acetyl-CoA acetyltransferase, mitochondrial
  • acetyl-Coenzyme A acetyltransferase 1
  • EC 2.3.1
  • EC 2.3.1.9
  • MAT
  • mitochondrial acetoacetyl-CoA thiolase
  • T2
  • THIL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-45981
Species: Hu
Applications: IHC, IHC-P
NB100-64852
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
210-TA
Species: Hu
Applications: BA
D6050
Species: Hu
Applications: ELISA
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for ACAT1 Antibody (NBP1-89284)(5)

Review for ACAT1 Antibody (NBP1-89284) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Pig.

Reviews using NBP1-89284:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Pig
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ACAT1 NBP1-89284
Enlarge
5
reviewed by:
Verified Customer
WB Pig 07/24/2018
View

Summary

ApplicationWestern Blot
Sample TestedBrain (cerebral cortex),brain cortical homogenate
SpeciesPig
LotA113800

Comments

Commentsprimary concentration 1:500, Secondary concentration 1:10,000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACAT1 Antibody (NBP1-89284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAT1 Products

Bioinformatics Tool for ACAT1 Antibody (NBP1-89284)

Discover related pathways, diseases and genes to ACAT1 Antibody (NBP1-89284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT1 Antibody (NBP1-89284)

Discover more about diseases related to ACAT1 Antibody (NBP1-89284).
 

Pathways for ACAT1 Antibody (NBP1-89284)

View related products by pathway.

PTMs for ACAT1 Antibody (NBP1-89284)

Learn more about PTMs related to ACAT1 Antibody (NBP1-89284).
 

Research Areas for ACAT1 Antibody (NBP1-89284)

Find related products by research area.

Blogs on ACAT1

There are no specific blogs for ACAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
07/24/2018
Application: WB
Species: Pig

Bioinformatics

Gene Symbol ACAT1