ACAT1 Antibody

Images

 
Western Blot: ACAT1 Antibody [NBP1-89284] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACAT1 Protein (NBP1-89284PEP)
Publications
Read Publications using NBP1-89284.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%). Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAT1 Antibody

  • ACAT
  • acetoacetyl Coenzyme A thiolase
  • Acetoacetyl-CoA thiolase
  • acetyl-CoA acetyltransferase 1
  • acetyl-CoA acetyltransferase, mitochondrial
  • acetyl-Coenzyme A acetyltransferase 1
  • EC 2.3.1
  • EC 2.3.1.9
  • MAT
  • mitochondrial acetoacetyl-CoA thiolase
  • T2
  • THIL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-45981
Species: Hu
Applications: IHC
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ACAT1 Antibody (NBP1-89284)(5)

Reviews for ACAT1 Antibody (NBP1-89284) (0)

There are no reviews for ACAT1 Antibody (NBP1-89284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACAT1 Antibody (NBP1-89284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAT1 Products

ACAT1 NBP1-89284

Bioinformatics Tool for ACAT1 Antibody (NBP1-89284)

Discover related pathways, diseases and genes to ACAT1 Antibody (NBP1-89284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT1 Antibody (NBP1-89284)

Discover more about diseases related to ACAT1 Antibody (NBP1-89284).
 

Pathways for ACAT1 Antibody (NBP1-89284)

View related products by pathway.

PTMs for ACAT1 Antibody (NBP1-89284)

Learn more about PTMs related to ACAT1 Antibody (NBP1-89284).
 

Research Areas for ACAT1 Antibody (NBP1-89284)

Find related products by research area.

Blogs on ACAT1

There are no specific blogs for ACAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAT1