HGF Antibody

Images

 
Immunohistochemistry: HGF Antibody [NBP2-48806] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HGF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA
Specificity
Specificity of human HGF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HGF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HGF Recombinant Protein Antigen (NBP2-48806PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HGF Antibody

  • deafness, autosomal recessive 39
  • DFNB39
  • EC 3.4.21
  • EC 3.4.21.7
  • fibroblast-derived tumor cytotoxic factor
  • F-TCF
  • hepatocyte growth factor (hepapoietin A; scatter factor)
  • Hepatopoeitin-A
  • Hepatopoietin A
  • HGF
  • HGFB
  • HPTAhepatocyte growth factor
  • lung fibroblast-derived mitogen
  • Scatter factor
  • SF
  • SFhepatopoeitin-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for HGF Antibody (NBP2-48806) (0)

There are no publications for HGF Antibody (NBP2-48806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGF Antibody (NBP2-48806) (0)

There are no reviews for HGF Antibody (NBP2-48806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HGF Antibody (NBP2-48806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HGF Antibody (NBP2-48806)

Discover related pathways, diseases and genes to HGF Antibody (NBP2-48806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGF Antibody (NBP2-48806)

Discover more about diseases related to HGF Antibody (NBP2-48806).
 

Pathways for HGF Antibody (NBP2-48806)

View related products by pathway.

PTMs for HGF Antibody (NBP2-48806)

Learn more about PTMs related to HGF Antibody (NBP2-48806).
 

Research Areas for HGF Antibody (NBP2-48806)

Find related products by research area.

Blogs on HGF.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

The role of HIF-2 alpha in the progression and therapy of clear cell renal cell carcinoma
HIF-2 alpha, also known as hypoxia-inducible factor 2, endothelial PAS domain protein-1, and member of PAS superfamily 2 is part of the HIF family of proteins.  The HIF family is composed of HIF-1, HIF-2 and HIF-3, where HIF-2 is a dimeric protein...  Read full blog post.

VEGFR-2 - A highly active kinase
VEGFR-2 is a family member of the vascular endothelial growth factor (VEGF) family of membrane receptor tyrosine kinases. It is a key regulator of the process of angiogenesis that takes place during fundamental developmental processes such as embry...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HGF
Entrez