HDAC10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HDAC10 Antibody [NBP2-56663] - Staining of human cell line MCF7 shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDAC10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKMLQC
Specificity
Specificity of human HDAC10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDAC10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HDAC10 Recombinant Protein Antigen (NBP2-56663PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HDAC10 Antibody

  • DKFZP761B039
  • EC 3.5.1.98
  • HD10
  • histone deacetylase 10
  • MGC149722

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IP
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP2-16789
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-44092
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22151
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP2-67837
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready, KO
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HDAC10 Antibody (NBP2-56663) (0)

There are no publications for HDAC10 Antibody (NBP2-56663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC10 Antibody (NBP2-56663) (0)

There are no reviews for HDAC10 Antibody (NBP2-56663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HDAC10 Antibody (NBP2-56663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HDAC10 Products

Bioinformatics Tool for HDAC10 Antibody (NBP2-56663)

Discover related pathways, diseases and genes to HDAC10 Antibody (NBP2-56663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC10 Antibody (NBP2-56663)

Discover more about diseases related to HDAC10 Antibody (NBP2-56663).
 

Pathways for HDAC10 Antibody (NBP2-56663)

View related products by pathway.

PTMs for HDAC10 Antibody (NBP2-56663)

Learn more about PTMs related to HDAC10 Antibody (NBP2-56663).
 

Research Areas for HDAC10 Antibody (NBP2-56663)

Find related products by research area.

Blogs on HDAC10

There are no specific blogs for HDAC10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC10