GTF2IRD1 Antibody

Images

 
Western Blot: GTF2IRD1 Antibody [NBP1-91973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GTF2IRD1 Antibody [NBP1-91973] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GTF2IRD1 Antibody [NBP1-91973] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: GTF2IRD1 Antibody [NBP1-91973] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GTF2IRD1 Antibody [NBP1-91973] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: GTF2IRD1 Antibody [NBP1-91973] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2IRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD
Specificity
Specificity of human GTF2IRD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2IRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockout Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ChIP and Knockout validation (Kopp et al).
Control Peptide
GTF2IRD1 Protein (NBP1-91973PEP)
Publications
Read Publications using
NBP1-91973 in the following applications:

  • 1 publication
  • KO
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31418010).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTF2IRD1 Antibody

  • BEN
  • CREAM1
  • general transcription factor II-I repeat domain-containing protein 1
  • General transcription factor III
  • GTF2I repeat domain containing 1
  • GTF2I repeat domain-containing protein 1
  • GTF3GTF2I repeat domain-containing 1
  • hMusTRD1alpha1
  • muscle TFII-I repeat domain-containing protein 1 alpha 1
  • Muscle TFII-I repeat domain-containing protein 1
  • MusTRD1
  • MusTRD1/BEN
  • MUSTRD1general transcription factor 3
  • RBAP2WBSCR12binding factor for early enhancer
  • Slow-muscle-fiber enhancer-binding protein
  • USE B1-binding protein
  • WBS
  • WBSCR11
  • Williams-Beuren syndrome chromosomal region 11 protein
  • Williams-Beuren syndrome chromosomal region 12 protein
  • Williams-Beuren syndrome chromosome region 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-90010
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00006941-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-47935
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1414
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
NBP1-91973
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, KO

Publications for GTF2IRD1 Antibody (NBP1-91973)(4)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ChIP, KO, WB.


Filter By Application
ChIP
(1)
KO
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 4 of 4.
Publications using NBP1-91973 Applications Species
Hasegawa Y, Ikeda K, Chen Y et al. Repression of Adipose Tissue Fibrosis through a PRDM16-GTF2IRD1 Complex Improves Systemic Glucose Homeostasis Cell Metab. 2018 Jan 09 [PMID: 29320702] (Human) Human
Kopp N, McCullough K, Maloney SE, Dougherty JD Gtf2i and Gtf2ird1 mutation do not account for the full phenotypic effect of the Williams syndrome critical region in mouse models Hum. Mol. Genet. Aug 16 2019 [PMID: 31418010] (Mouse) Mouse
Kopp ND, Nygaard KR, McCullough KB, Maloney SE Functions of Gtf2i and Gtf2ird1 in the developing brain: transcription, DNA-binding, and long term behavioral consequences bioRxiv Dec 3 2019 (WB, ChIP, KO, Mouse) WB, ChIP, KO Mouse

Reviews for GTF2IRD1 Antibody (NBP1-91973) (0)

There are no reviews for GTF2IRD1 Antibody (NBP1-91973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for GTF2IRD1 Antibody (NBP1-91973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GTF2IRD1 Products

Bioinformatics Tool for GTF2IRD1 Antibody (NBP1-91973)

Discover related pathways, diseases and genes to GTF2IRD1 Antibody (NBP1-91973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2IRD1 Antibody (NBP1-91973)

Discover more about diseases related to GTF2IRD1 Antibody (NBP1-91973).
 

Pathways for GTF2IRD1 Antibody (NBP1-91973)

View related products by pathway.

PTMs for GTF2IRD1 Antibody (NBP1-91973)

Learn more about PTMs related to GTF2IRD1 Antibody (NBP1-91973).

Blogs on GTF2IRD1

There are no specific blogs for GTF2IRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2IRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2IRD1