TCF19 Antibody (6D8) Summary
Immunogen |
TCF19 (NP_009040, 17 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL |
Specificity |
TCF19 - transcription factor 19 (SC1) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TCF19 |
Purity |
Ascites |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Knockdown Validated
- Western Blot
|
Application Notes |
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Ascites |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TCF19 Antibody (6D8)
Background
The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
Publications for TCF19 Antibody (H00006941-M01) (0)
There are no publications for TCF19 Antibody (H00006941-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TCF19 Antibody (H00006941-M01) (0)
There are no reviews for TCF19 Antibody (H00006941-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCF19 Antibody (H00006941-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCF19 Products
Bioinformatics Tool for TCF19 Antibody (H00006941-M01)
Discover related pathways, diseases and genes to TCF19 Antibody (H00006941-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TCF19 Antibody (H00006941-M01)
Discover more about diseases related to TCF19 Antibody (H00006941-M01).
| | Pathways for TCF19 Antibody (H00006941-M01)
View related products by pathway.
|
Research Areas for TCF19 Antibody (H00006941-M01)
Find related products by research area.
|
Blogs on TCF19