TCF19 Antibody (6D8)

Images

 
Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: ...read more
ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
6D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCF19 Antibody (6D8) Summary

Immunogen
TCF19 (NP_009040, 17 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
Specificity
TCF19 - transcription factor 19 (SC1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCF19
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF19 Antibody (6D8)

  • SC1(TCF19)-6
  • SC1-1
  • SC1SC1(TCF19)-7
  • SCI(TCF19)-4
  • TCF-19
  • transcription factor 19
  • Transcription factor SC1

Background

The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB2327
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCF19 Antibody (H00006941-M01) (0)

There are no publications for TCF19 Antibody (H00006941-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF19 Antibody (H00006941-M01) (0)

There are no reviews for TCF19 Antibody (H00006941-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF19 Antibody (H00006941-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF19 Products

Bioinformatics Tool for TCF19 Antibody (H00006941-M01)

Discover related pathways, diseases and genes to TCF19 Antibody (H00006941-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF19 Antibody (H00006941-M01)

Discover more about diseases related to TCF19 Antibody (H00006941-M01).
 

Pathways for TCF19 Antibody (H00006941-M01)

View related products by pathway.

Research Areas for TCF19 Antibody (H00006941-M01)

Find related products by research area.

Blogs on TCF19

There are no specific blogs for TCF19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF19 Antibody (6D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF19
Entrez
OMIM
Uniprot