gp96/HSP90B1/GRP94 Antibody

Images

 
Genetic Strategies: Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSP90B1 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining in human thyroid gland and skeletal muscle tissues using anti-HSP90B1 antibody. Corresponding HSP90B1 RNA-seq data are presented for the ...read more
Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody [NBP1-81802] - Staining of human thyroid gland shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

gp96/HSP90B1/GRP94 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS
Marker
ER Stress Marker
Specificity
Specificity of human, mouse gp96/HSP90B1/GRP94 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSP90B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
gp96/HSP90B1/GRP94 Lysate (NBP2-65662)
Control Peptide
gp96/HSP90B1/GRP94 Protein (NBP1-81802PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for gp96/HSP90B1/GRP94 Antibody

  • 94 kDa glucose-regulated protein
  • ECGP
  • Endoplasmin
  • endothelial cell (HBMEC) glycoprotein
  • glucose regulated protein, 94 kDa
  • gp96
  • GP96ECGP
  • Grp94
  • GRP-94
  • GRP94gp96 homolog
  • Heat shock protein 90 kDa beta member 1
  • heat shock protein 90kDa beta (Grp94), member 1
  • HSP90B1
  • TRA1endoplasmin
  • tumor rejection antigen (gp96) 1
  • Tumor rejection antigen 1
  • Tumor rejection antigen-1 (gp96)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1543
Species: Hu
Applications: WB, IHC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-77681
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC

Publications for gp96/HSP90B1/GRP94 Antibody (NBP1-81802) (0)

There are no publications for gp96/HSP90B1/GRP94 Antibody (NBP1-81802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gp96/HSP90B1/GRP94 Antibody (NBP1-81802) (0)

There are no reviews for gp96/HSP90B1/GRP94 Antibody (NBP1-81802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for gp96/HSP90B1/GRP94 Antibody (NBP1-81802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for gp96/HSP90B1/GRP94 Antibody (NBP1-81802)

Discover related pathways, diseases and genes to gp96/HSP90B1/GRP94 Antibody (NBP1-81802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gp96/HSP90B1/GRP94 Antibody (NBP1-81802)

Discover more about diseases related to gp96/HSP90B1/GRP94 Antibody (NBP1-81802).
 

Pathways for gp96/HSP90B1/GRP94 Antibody (NBP1-81802)

View related products by pathway.

PTMs for gp96/HSP90B1/GRP94 Antibody (NBP1-81802)

Learn more about PTMs related to gp96/HSP90B1/GRP94 Antibody (NBP1-81802).

Blogs on gp96/HSP90B1/GRP94

There are no specific blogs for gp96/HSP90B1/GRP94, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gp96/HSP90B1/GRP94 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSP90B1
Entrez