Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free

Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Mouse heart using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Rat brain using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free [Gastrin-releasing Peptide/Bombesin/Neuromedin C] - Immunofluorescence analysis of NIH/3T3 cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free [Gastrin-releasing Peptide/Bombesin/Neuromedin C] - Immunofluorescence analysis of PC-12 cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free (NBP3-03282) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human Gastrin-releasing Peptide/Bombesin/Neuromedin C (NP_002082.2). MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free

• BN
• Bombesin
• Gastrinreleasing Peptide
• Gastrin-releasing Peptide
• GRP
• GRP10
• GRP-10
• neuromedin C
• pre-progastrin releasing peptide
• preproGRP
• proGRP

Background

Gastrin-releasing peptide receptor (GRPR) is a Bombesin Receptor. In addition to its involvement in autism and mental retardation, GRPR may also play a role in the progression of cancer. Nicotine exposure induces an increase in GRPR expression in the lung Shriver et al. (2000). GRPR has been reported in brain, breast, colon, lung, lymph node, ovary, placenta, prostate, stomach, and uterus. It has also been shown to be expressed in several cancers, including those in breast, colon, lung, ovary, pancreas, and prostate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRP