Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free

Images

 
Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 ...read more
Immunocytochemistry/ Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Immunofluorescence analysis of HeLa cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody ...read more
Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Mouse heart using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x ...read more
Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 ...read more
Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Rat brain using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human Gastrin-releasing Peptide/Bombesin/Neuromedin C (NP_002082.2). MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free

  • BN
  • Bombesin
  • Gastrinreleasing Peptide
  • Gastrin-releasing Peptide
  • GRP
  • GRP10
  • GRP-10
  • neuromedin C
  • pre-progastrin releasing peptide
  • preproGRP
  • proGRP

Background

Gastrin-releasing peptide receptor (GRPR) is a Bombesin Receptor. In addition to its involvement in autism and mental retardation, GRPR may also play a role in the progression of cancer. Nicotine exposure induces an increase in GRPR expression in the lung Shriver et al. (2000). GRPR has been reported in brain, breast, colon, lung, lymph node, ovary, placenta, prostate, stomach, and uterus. It has also been shown to be expressed in several cancers, including those in breast, colon, lung, ovary, pancreas, and prostate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282) (0)

There are no publications for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282) (0)

There are no reviews for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastrin-releasing Peptide/Bombesin/Neuromedin C Products

Research Areas for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282)

Find related products by research area.

Blogs on Gastrin-releasing Peptide/Bombesin/Neuromedin C

There are no specific blogs for Gastrin-releasing Peptide/Bombesin/Neuromedin C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GRP