GnRH Antibody


Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human hypothalamus shows strong cytoplasmic positivity in subsets of neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GnRH Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Specificity of human GnRH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GnRH Protein (NBP1-89749PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GnRH Antibody

  • GNRH
  • GnRH-associated peptide 1
  • gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
  • gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
  • GRH
  • LHRH
  • LNRH
  • luliberin I
  • Progonadoliberin I
  • progonadoliberin-1
  • prolactin release-inhibiting factor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC

Publications for GnRH Antibody (NBP1-89749) (0)

There are no publications for GnRH Antibody (NBP1-89749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GnRH Antibody (NBP1-89749) (0)

There are no reviews for GnRH Antibody (NBP1-89749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GnRH Antibody (NBP1-89749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GnRH Products

Bioinformatics Tool for GnRH Antibody (NBP1-89749)

Discover related pathways, diseases and genes to GnRH Antibody (NBP1-89749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GnRH Antibody (NBP1-89749)

Discover more about diseases related to GnRH Antibody (NBP1-89749).

Pathways for GnRH Antibody (NBP1-89749)

View related products by pathway.

PTMs for GnRH Antibody (NBP1-89749)

Learn more about PTMs related to GnRH Antibody (NBP1-89749).

Research Areas for GnRH Antibody (NBP1-89749)

Find related products by research area.

Blogs on GnRH.

The Use of RNA Polymerase II Antibodies In Proteasome Regulation Studies
At Novus Biologicals, we recently added a new RNA Polymerase II antibody (clone 4H8) to our antibody catalog. RNAPII is an essential transcription enzyme, catalyzing the transcription of DNA during the elongation stage of mRNA synthesis (known as the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GnRH Antibody and receive a gift card or discount.


Gene Symbol GNRH1