GnRH Antibody - BSA Free

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of rat brain shows strong cytoplasmic positivity in neurons in anterior hypothalamus.

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human hypothalamus shows moderate cytoplasmic positivity in a subset of neurons.

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human cerebellum shows very weak positivity in neuronal processes.

Immunohistochemistry-Paraffin: GnRH Antibody [NBP1-89749] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GnRH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GnRH Antibody - BSA Free (NBP1-89749) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNRH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GnRH Protein (NBP1-89749PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GnRH Antibody - BSA Free

• GNRH
• GnRH-associated peptide 1
• gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
• gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
• GRH
• LHRH
• LNRH
• luliberin I
• Progonadoliberin I
• progonadoliberin-1
• prolactin release-inhibiting factor

Background

Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNRH1